![Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human cerebral cortex, colon, liver and testis using Anti-QARS antibody NBP1-89487 (A) shows similar protein distribution across tissues to independent antibody NBP2-37883 (B).](http://images.novusbio.com/fullsize/QARS-Antibody-Immunohistochemistry-Paraffin-NBP1-89487-img0009.jpg "Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human cerebral cortex, colon, liver and testis using Anti-QARS antibody NBP1-89487 (A) shows similar protein distribution across tissues to independent antibody NBP2-37883 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | QARS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89487 | Applications | Species |
|---|---|---|
| Kong J, Kim S Cell-based analysis of pairwise interactions between the components of the multi-tRNA synthetase complex FASEB J. 2020-06-15 [PMID: 32539228] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | QARS1 |
![Western Blot: QARS Antibody [NBP1-89487] - Analysis using Anti-QARS antibody NBP1-89487 (A) shows similar pattern to independent antibody NBP2-37883 (B).](http://images.novusbio.com/fullsize/QARS-Antibody-Western-Blot-NBP1-89487-img0010.jpg "Western Blot: QARS Antibody [NBP1-89487] - Analysis using Anti-QARS antibody NBP1-89487 (A) shows similar pattern to independent antibody NBP2-37883 (B).")
![Immunocytochemistry/Immunofluorescence: QARS Antibody [NBP1-89487] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/QARS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89487-img0007.jpg "Immunocytochemistry/Immunofluorescence: QARS Antibody [NBP1-89487] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/QARS-Antibody-Immunohistochemistry-Paraffin-NBP1-89487-img0013.jpg "Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human cerebral cortex.")
![Western Blot: QARS Antibody [NBP1-89487] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/QARS-Antibody-Western-Blot-NBP1-89487-img0006.jpg "Western Blot: QARS Antibody [NBP1-89487] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human liver.](http://images.novusbio.com/fullsize/QARS-Antibody-Immunohistochemistry-Paraffin-NBP1-89487-img0011.jpg "Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human liver.")
![Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human colon.](http://images.novusbio.com/fullsize/QARS-Antibody-Immunohistochemistry-Paraffin-NBP1-89487-img0012.jpg "Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human colon.")
![Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human testis.](http://images.novusbio.com/fullsize/QARS-Antibody-Immunohistochemistry-Paraffin-NBP1-89487-img0014.jpg "Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human testis.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")