![Western Blot: NARS Antibody [NBP2-13640] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/NARS-Antibody-Western-Blot-NBP2-13640-img0005.jpg "Western Blot: NARS Antibody [NBP2-13640] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: RLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NARS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NARS Antibody (NBP2-13640)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NARS1 |
![Immunocytochemistry/Immunofluorescence: NARS Antibody [NBP2-13640] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.](http://images.novusbio.com/fullsize/NARS-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13640-img0006.jpg "Immunocytochemistry/Immunofluorescence: NARS Antibody [NBP2-13640] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.")
![Immunohistochemistry-Paraffin: NARS Antibody [NBP2-13640] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NARS-Antibody-Immunohistochemistry-Paraffin-NBP2-13640-img0010.jpg "Immunohistochemistry-Paraffin: NARS Antibody [NBP2-13640] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.")
![Western Blot: NARS Antibody [NBP2-13640] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/NARS-Antibody-Western-Blot-NBP2-13640-img0004.jpg "Western Blot: NARS Antibody [NBP2-13640] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: NARS Antibody [NBP2-13640] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/NARS-Antibody-Immunohistochemistry-Paraffin-NBP2-13640-img0007.jpg "Immunohistochemistry-Paraffin: NARS Antibody [NBP2-13640] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: NARS Antibody [NBP2-13640] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/NARS-Antibody-Immunohistochemistry-Paraffin-NBP2-13640-img0008.jpg "Immunohistochemistry-Paraffin: NARS Antibody [NBP2-13640] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: NARS Antibody [NBP2-13640] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/NARS-Antibody-Immunohistochemistry-Paraffin-NBP2-13640-img0009.jpg "Immunohistochemistry-Paraffin: NARS Antibody [NBP2-13640] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")