![Western Blot: PPP2R1B Antibody [NBP1-87251] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/PPP2R1B-Antibody-Western-Blot-NBP1-87251-img0005.jpg "Western Blot: PPP2R1B Antibody [NBP1-87251] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PPP2R1B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PPP2R1B Antibody (NBP1-87251)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PPP2R1B |
![Immunocytochemistry/Immunofluorescence: PPP2R1B Antibody [NBP1-87251] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PPP2R1B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87251-img0007.jpg "Immunocytochemistry/Immunofluorescence: PPP2R1B Antibody [NBP1-87251] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PPP2R1B Antibody [NBP1-87251] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PPP2R1B-Antibody-Immunohistochemistry-Paraffin-NBP1-87251-img0010.jpg "Immunohistochemistry-Paraffin: PPP2R1B Antibody [NBP1-87251] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: PPP2R1B Antibody [NBP1-87251] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PPP2R1B-Antibody-Immunohistochemistry-Paraffin-NBP1-87251-img0006.jpg "Immunohistochemistry-Paraffin: PPP2R1B Antibody [NBP1-87251] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: PPP2R1B Antibody [NBP1-87251] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PPP2R1B-Antibody-Immunohistochemistry-Paraffin-NBP1-87251-img0008.jpg "Immunohistochemistry-Paraffin: PPP2R1B Antibody [NBP1-87251] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PPP2R1B Antibody [NBP1-87251] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PPP2R1B-Antibody-Immunohistochemistry-Paraffin-NBP1-87251-img0009.jpg "Immunohistochemistry-Paraffin: PPP2R1B Antibody [NBP1-87251] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PPP2R1B Antibody [NBP1-87251] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal and non germinal center cells.](http://images.novusbio.com/fullsize/PPP2R1B-Antibody-Immunohistochemistry-Paraffin-NBP1-87251-img0011.jpg "Immunohistochemistry-Paraffin: PPP2R1B Antibody [NBP1-87251] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal and non germinal center cells.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")