![Western Blot: PPIL3 Antibody [NBP2-13794] - Analysis in human cell line HEL.](http://images.novusbio.com/fullsize/PPIL3-Antibody-Western-Blot-NBP2-13794-img0008.jpg "Western Blot: PPIL3 Antibody [NBP2-13794] - Analysis in human cell line HEL.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: GSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PPIL3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PPIL3 |
![Immunocytochemistry/Immunofluorescence: PPIL3 Antibody [NBP2-13794] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/PPIL3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13794-img0007.jpg "Immunocytochemistry/Immunofluorescence: PPIL3 Antibody [NBP2-13794] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/PPIL3-Antibody-Immunohistochemistry-Paraffin-NBP2-13794-img0012.jpg "Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal and non-germinal center cells.](http://images.novusbio.com/fullsize/PPIL3-Antibody-Immunohistochemistry-Paraffin-NBP2-13794-img0009.jpg "Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal and non-germinal center cells.")
![Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human testis showing moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PPIL3-Antibody-Immunohistochemistry-Paraffin-NBP2-13794-img0010.jpg "Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human testis showing moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human small intestine shows strong cytoplamic postitiity in glandular cells.](http://images.novusbio.com/fullsize/PPIL3-Antibody-Immunohistochemistry-Paraffin-NBP2-13794-img0011.jpg "Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human small intestine shows strong cytoplamic postitiity in glandular cells.")
![Western Blot Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Western_Blot_6024.jpg)
![Immunocytochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunocytochemistry__Immunofluorescence_23049.jpg)
![Immunohistochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunohistochemistry_7360.jpg)
![Western Blot FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Western_Blot_5399.jpg)
![Simple Western FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Simple_Western_16755.jpg)
![Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Immunohistochemistry_6823.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")