![Western Blot: FKBP14 Antibody [H00055033-B01P] - Analysis of FKBP14 expression in human kidney.](http://images.novusbio.com/fullsize/FKBP14-Antibody-Western-Blot-H00055033-B01P-img0003.jpg "Western Blot: FKBP14 Antibody [H00055033-B01P] - Analysis of FKBP14 expression in human kidney.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | FKBP14 (NP_060416.1, 1 a.a. - 211 a.a.) full-length human protein. MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL |
| Specificity | FKBP14 - FK506 binding protein 14, 22 kDa, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | FKBP14 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FKBP14 |
| Entrez |
|
| Uniprot |
|
![Western Blot: FKBP14 Antibody [H00055033-B01P] - Analysis of FKBP14 expression in transfected 293T cell line by FKBP14 polyclonal antibody. Lane 1: FKBP14 transfected lysate(23.21 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/FKBP14-Antibody-Western-Blot-H00055033-B01P-img0004.jpg "Western Blot: FKBP14 Antibody [H00055033-B01P] - Analysis of FKBP14 expression in transfected 293T cell line by FKBP14 polyclonal antibody. Lane 1: FKBP14 transfected lysate(23.21 KDa). Lane 2: Non-transfected lysate.")
![Western Blot FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Western_Blot_5399.jpg)
![Simple Western FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Simple_Western_16755.jpg)
![Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Immunohistochemistry_6823.jpg)
![Western Blot FKBP12.6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP12.6_AF4174_Western_Blot_5411.jpg)
![Simple Western FKBP12.6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP12.6_AF4174_Simple_Western_16756.jpg)
![Immunohistochemistry FKBP12.6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP12.6_AF4174_Immunohistochemistry_22269.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")