![Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Analysis in human endometrium and skeletal muscle tissues using NBP2-49242 antibody. Corresponding FKBP10 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/FKBP10-Antibody-Immunohistochemistry-Paraffin-NBP2-49242-img0006.jpg "Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Analysis in human endometrium and skeletal muscle tissues using NBP2-49242 antibody. Corresponding FKBP10 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLPTGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDGKITV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FKBP10 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FKBP10 |
![Western Blot: FKBP10 Antibody [NBP2-49242] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG](http://images.novusbio.com/fullsize/FKBP10-Antibody-Western-Blot-NBP2-49242-img0002.jpg "Western Blot: FKBP10 Antibody [NBP2-49242] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG")
![Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human placenta shows moderate to strong cytoplasmic positivity in fibroblasts.](http://images.novusbio.com/fullsize/FKBP10-Antibody-Immunohistochemistry-Paraffin-NBP2-49242-img0009.jpg "Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human placenta shows moderate to strong cytoplasmic positivity in fibroblasts.")
![Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human endometrium shows strong cytoplasmic positivity in stromal cells.](http://images.novusbio.com/fullsize/FKBP10-Antibody-Immunohistochemistry-Paraffin-NBP2-49242-img0007.jpg "Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human endometrium shows strong cytoplasmic positivity in stromal cells.")
![Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human uterine cervix shows strong cytoplasmic positivity in fibroblasts.](http://images.novusbio.com/fullsize/FKBP10-Antibody-Immunohistochemistry-Paraffin-NBP2-49242-img0008.jpg "Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human uterine cervix shows strong cytoplasmic positivity in fibroblasts.")
![Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/FKBP10-Antibody-Immunohistochemistry-Paraffin-NBP2-49242-img0010.jpg "Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Western_Blot_6024.jpg)
![Immunocytochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunocytochemistry__Immunofluorescence_23049.jpg)
![Immunohistochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunohistochemistry_7360.jpg)
![Western Blot FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Western_Blot_5399.jpg)
![Simple Western FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Simple_Western_16755.jpg)
![Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Immunohistochemistry_6823.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")