Novus Biologicals products are now on bio-techne.com

Podocalyxin Like Recombinant Protein Antigen

Name: Podocalyxin Like Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-83348PEP
Price: 279 USD

Submit a Review

Images

There are currently no images for Podocalyxin Like Recombinant Protein Antigen (NBP1-83348PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Podocalyxin Like Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PODXL. Source: E. coli Amino Acid Sequence: LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	PODXL
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83348. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Podocalyxin Like Recombinant Protein Antigen

GCTM
Gp200MGC138240
PCLP
PCLP1
PCLP-1
PCLPGCTM-2 antigen
PCpodocalyxin
POD XL
Podocalyxin
Podocalyxin-like protein 1
podocalyxin-like
PODXL

Background

Podocalyxin (PODXL) is a CD34 family member expressed by podocytes, vascular endothelium, mesothelium, and a subset of hematopoietic progenitors. It is the major sialoprotein in the glycocalyx of glomerular podocytes. The physiological role of podocalyxin in leukemic blasts is unknown. However, it is thought of as a candidate prostate cancer tumor aggressiveness gene. Podocalyxin appears to complement CD34 as a useful cell surface marker for hemangioblasts, the common precursors of hematopoietic and endothelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
HLA DRB4 GST (N-Term) ...

H00003126-P01

(1 Publication)

Species: Hu

Applications: ELISA, AP, PA, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(817 Publications)

Species: Hu

Applications: BA

HLA DRB1 Antibody
(SPM288)

NBP2-45312

Flow Cytometry HLA DRB1 Antibody (SPM288)

Immunofluorescence HLA DRB1 Antibody (SPM288)

(2 Publications)

Species: Hu, Pm, Mu(-)

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Dihydrofolate
Reductase/DHFR Antibo ...

H00001719-M01

(12 Publications)

Species: Hu, Mu, Rt, Ye

Applications: ELISA, ICC/IF, S-ELISA, WB

Exosome component
10 Antibody

NBP1-32870

Immunohistochemistry-Paraffin Exosome component 10 Antibody

(2 Reviews)

(3 Publications)

Species: Hu

Applications: IHC, IHC-P, IP, KD, WB

Nephrin Antibody
[Unconjugated]

AF3159

Immunocytochemistry/ Immunofluorescence Nephrin Antibody [Unconjugated]

(58 Publications)

Species: Mu

Applications: IHC

HLA B Antibody
(2G7B10) - BSA Free

NBP2-61871

Flow Cytometry HLA B Antibody (2G7B10) - BSA Free

Immunocytochemistry/ Immunofluorescence HLA B Antibody (2G7B10) - BSA Free

Species: Hu

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

HLA ABC Antibody
(W6/32)

NB100-64775

Immunohistochemistry-Frozen HLA ABC Antibody (W6/32)

(2 Reviews)

(31 Publications)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, Func, IHC, IHC-Fr, IHC-P (-), IP

CD34 Antibody
[Unconjugated]

AF4117

(3 Reviews)

(37 Publications)

Species: Rt

Applications: IHC, WB

LIGHT/TNFSF14
[Unconjugated]

664-LI

Bioactivity LIGHT/TNFSF14 [Unconjugated]

(21 Publications)

Species: Hu

Applications: BA

HLA DRB3 Antibody
(Bra30)

NBP3-07168

Species: Pm, Ca, Pm, Hu, Pm, Sq

Applications: Flow, ICC/IF

HLA DPB1 Antibody

NBP3-35275

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Albumin Antibody
(188835) [Unconjugate ...

MAB1455

Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum

Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum

(3 Reviews)

(54 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

FABP8/M-FABP/Myelin P2

AF5866

Immunohistochemistry FABP8/M-FABP/Myelin P2 Protein Antibody

Species: Hu

Applications: IHC, WB

RPLP2 Antibody

NBP2-15104

Immunohistochemistry-Paraffin RPLP2 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

HLA DRB5 Antibody

NBP2-14093

Species: Hu

Applications: IHC, IHC-P, WB

Cytochrome c
Antibody (7H8.2C12) - ...

NB100-56503

Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free

Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free

(61 Publications)

Species: Dr, Hu, Mu, Rb, Rt

Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB

Caspase-3 Antibody
[Unconjugated] - Acti ...

AF835

Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active

(7 Reviews)

(389 Publications)

Species: Hu, Mu

Applications: ICC, IHC

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

Podocalyxin Like
Recombinant Protein A ...

NBP1-83348PEP

Species: Hu

Applications: AC

Publications for Podocalyxin Like Recombinant Protein Antigen (NBP1-83348PEP) (0)

There are no publications for Podocalyxin Like Recombinant Protein Antigen (NBP1-83348PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Podocalyxin Like Recombinant Protein Antigen (NBP1-83348PEP) (0)

There are no reviews for Podocalyxin Like Recombinant Protein Antigen (NBP1-83348PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Podocalyxin Like Recombinant Protein Antigen (NBP1-83348PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Podocalyxin Like Products

Research Areas for Podocalyxin Like Recombinant Protein Antigen (NBP1-83348PEP)

Find related products by research area.

Blogs on Podocalyxin Like

There are no specific blogs for Podocalyxin Like, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Podocalyxin was detected in perfusion fixed frozen sections of mouse thymus using Goat Anti-Mouse Podocalyxin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1556) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling when primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. Specific staining was localized to high endothelial venules. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.

Podocalyxin Like Antibody [Unconjugated]
AF1556

Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Podocalyxin Like Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

PODXL

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Podocalyxin Like Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Podocalyxin Like Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Podocalyxin Like Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Podocalyxin Like Recombinant Protein Antigen (NBP1-83348PEP) (0)

Reviews for Podocalyxin Like Recombinant Protein Antigen (NBP1-83348PEP) (0)

FAQs for Podocalyxin Like Recombinant Protein Antigen (NBP1-83348PEP) (0)

Additional Podocalyxin Like Products

Research Areas for Podocalyxin Like Recombinant Protein Antigen (NBP1-83348PEP)

Blogs on Podocalyxin Like

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics