Home » PERP » PERP Proteins » PERP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PERP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PERP Protein (NBP1-85173PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PERP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PERP.

Source: E. coli

Amino Acid Sequence: LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PERP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85173.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PERP Recombinant Protein Antigen

  • dJ496H19.1
  • KCP1KCP-1
  • Keratinocyte-associated protein 1
  • KRTCAP11110017A08Rik
  • p53 apoptosis effector related to PMP22
  • p53 apoptosis effector related to PMP-22
  • P53-induced protein PIGPC1
  • PERP, TP53 apoptosis effector
  • PIGPC1RP3-496H19.1
  • THWkeratinocytes associated protein 1
  • Transmembrane protein THW

Background

The p53 tumor suppressor activates either cell cycle arrest or apoptosis in response to cellular stress. A novel gene, PERP, is expressed in a p53-dependent manner and at high levels in apoptotic cells compared with G(1)-arrested cells. PERP induction is linked to p53-dependent apoptosis and is directly activated by p53. These data suggest that PERP is a novel effector of p53-dependent apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
p63/TP73L Antibody
[Unconjugated]
AF1916
Immunohistochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Hu
Applications: ICC, IHC, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CKAP4/p63 Antibody
[Unconjugated]
AF7355
Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]
Western Blot CKAP4/p63 Antibody [Unconjugated]
Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot Bax Antibody (6A7)
Western Blot Bax Antibody (6A7)
Immunohistochemistry-Frozen Bax Antibody (6A7)
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
RPE65 Antibody
(401.8B11.3D9) - BSA ...
NB100-355
Immunocytochemistry/ Immunofluorescence RPE65 Antibody (401.8B11.3D9) - BSA Free
Immunohistochemistry-Frozen RPE65 Antibody (401.8B11.3D9) - BSA Free
Western Blot RPE65 Antibody (401.8B11.3D9) - BSA Free
(7 Reviews)
(98 Publications)
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
UVRAG Antibody
NBP1-18885
Immunohistochemistry-Paraffin UVRAG Antibody
Western Blot UVRAG Antibody
Western Blot UVRAG Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Noxa Antibody
(114C307.1) - Non-Rec ...
NB600-1159
Immunocytochemistry/ Immunofluorescence Noxa Antibody (114C307.1) - Non-Recombinant Monoclonal
Immunohistochemistry-Paraffin Noxa Antibody (114C307.1) - Non-Recombinant Monoclonal
Flow Cytometry Noxa Antibody (114C307.1) - Non-Recombinant Monoclonal
(2 Reviews)
(76 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PUMA Antibody -
BSA Free
NBP1-76639
Western Blot PUMA Antibody - BSA Free
Immunohistochemistry PUMA Antibody - BSA Free
Western Blot PUMA Antibody - BSA Free
(7 Publications)
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC, IHC-P, WB
MDM2/HDM2 Antibody
(SMP14) - BSA Free
NB100-2736
Western Blot MDM2/HDM2 Antibody (SMP14) - BSA Free
Immunohistochemistry-Paraffin MDM2/HDM2 Antibody (SMP14) - BSA Free
Immunohistochemistry-Paraffin MDM2/HDM2 Antibody (SMP14) - BSA Free
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
TRAILR2/TNFRSF10B
Antibody
NB100-56618
Immunohistochemistry-Paraffin TRAILR2/TNFRSF10B Antibody
Immunohistochemistry TRAILR2/TNFRSF10B Antibody
Western Blot TRAILR2/TNFRSF10B Antibody
(1 Review)
(43 Publications)
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
Tetraspanin-4
Antibody
NBP1-59438
Western Blot Tetraspanin-4 Antibody
Western Blot Tetraspanin-4 Antibody
Immunohistochemistry Tetraspanin-4 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Uroplakin Ib
Antibody
NBP1-80656
Western Blot Uroplakin Ib Antibody
Immunohistochemistry-Paraffin Uroplakin Ib Antibody
Western Blot Uroplakin Ib Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
PMP22 Antibody
(Hu1) - Azide and BSA ...
NBP2-80913
Immunohistochemistry PMP22 Antibody (Hu1) - Azide and BSA Free
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
PERP Recombinant
Protein Antigen
NBP1-85173PEP
PERP Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PERP Protein (NBP1-85173PEP) (0)

There are no publications for PERP Protein (NBP1-85173PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PERP Protein (NBP1-85173PEP) (0)

There are no reviews for PERP Protein (NBP1-85173PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PERP Protein (NBP1-85173PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PERP Products

Research Areas for PERP Protein (NBP1-85173PEP)

Find related products by research area.

Blogs on PERP

There are no specific blogs for PERP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PERP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PERP