![Western Blot: PDE6G Antibody [NBP2-93029] - Analysis of extracts of various cell lines, using PDE6G at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.](http://images.novusbio.com/fullsize/PDE6G-Antibody-Western-Blot-NBP2-93029-img0004.jpg "Western Blot: PDE6G Antibody [NBP2-93029] - Analysis of extracts of various cell lines, using PDE6G at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human PDE6G (NP_002593.1). MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PDE6G |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PDE6G Antibody (NBP2-93029)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PDE6G |
![Immunocytochemistry/Immunofluorescence: PDE6G Antibody [NBP2-93029] - Analysis of U-2 OS cells using PDE6G at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PDE6G-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93029-img0003.jpg "Immunocytochemistry/Immunofluorescence: PDE6G Antibody [NBP2-93029] - Analysis of U-2 OS cells using PDE6G at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: PDE6G Antibody [NBP2-93029] - Analysis of C6 cells using PDE6G at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PDE6G-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93029-img0001.jpg "Immunocytochemistry/Immunofluorescence: PDE6G Antibody [NBP2-93029] - Analysis of C6 cells using PDE6G at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: PDE6G Antibody [NBP2-93029] - Analysis of L929 cells using PDE6G at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PDE6G-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93029-img0002.jpg "Immunocytochemistry/Immunofluorescence: PDE6G Antibody [NBP2-93029] - Analysis of L929 cells using PDE6G at dilution of 1:100. Blue: DAPI for nuclear staining.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")