![Immunohistochemistry-Paraffin: PDE6A Antibody [NBP1-87312] - Staining of human cerebral cortex, endometrium, eye, retina and liver using Anti-PDE6A antibody NBP1-87312 (A) shows similar protein distribution across tissues to independent antibody NBP2-68985 (B).](http://images.novusbio.com/fullsize/PDE6A-Antibody-Immunohistochemistry-Paraffin-NBP1-87312-img0010.jpg "Immunohistochemistry-Paraffin: PDE6A Antibody [NBP1-87312] - Staining of human cerebral cortex, endometrium, eye, retina and liver using Anti-PDE6A antibody NBP1-87312 (A) shows similar protein distribution across tissues to independent antibody NBP2-68985 (B).")
| Reactivity | Hu, Mu, Pm, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPWECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALVRFMYSLSKGYRKITYHN |
| Predicted Species | Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PDE6A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PDE6A Antibody (NBP1-87312)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PDE6A |
![Western Blot: PDE6A Antibody [NBP1-87312] - Analysis in control (vector only transfected HEK293T lysate) and PDE6A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/PDE6A-Antibody-Western-Blot-NBP1-87312-img0005.jpg "Western Blot: PDE6A Antibody [NBP1-87312] - Analysis in control (vector only transfected HEK293T lysate) and PDE6A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: PDE6A Antibody [NBP1-87312] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/PDE6A-Antibody-Immunohistochemistry-Paraffin-NBP1-87312-img0012.jpg "Immunohistochemistry-Paraffin: PDE6A Antibody [NBP1-87312] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: PDE6A Antibody [NBP1-87312] - Staining of human retina shows moderate cytoplasmic positivity in rods.](http://images.novusbio.com/fullsize/PDE6A-Antibody-Immunohistochemistry-Paraffin-NBP1-87312-img0004.jpg "Immunohistochemistry-Paraffin: PDE6A Antibody [NBP1-87312] - Staining of human retina shows moderate cytoplasmic positivity in rods.")
![Immunohistochemistry-Paraffin: PDE6A Antibody [NBP1-87312] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/PDE6A-Antibody-Immunohistochemistry-Paraffin-NBP1-87312-img0011.jpg "Immunohistochemistry-Paraffin: PDE6A Antibody [NBP1-87312] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: PDE6A Antibody [NBP1-87312] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/PDE6A-Antibody-Immunohistochemistry-Paraffin-NBP1-87312-img0013.jpg "Immunohistochemistry-Paraffin: PDE6A Antibody [NBP1-87312] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Flow Cytometry Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Flow_Cytometry_12100.jpg)
![Immunohistochemistry Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Immunohistochemistry_22755.jpg)
![Dual RNAscope ISH-IHC Compatible Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Dual_RNAscope_ISHIHC_23834.jpg)
![Immunocytochemistry/ Immunofluorescence PNR/NR2E3 Antibody (H7223) [Unconjugated]](https://images.novusbio.com/images/pp-h7223-00_human-pnr-nr2e3-mab-clone-h7223-41202412514869.jpg)
![Immunocytochemistry/ Immunofluorescence PNR/NR2E3 Antibody (H7223) [Unconjugated]](https://images.novusbio.com/images/pp-h7223-00_human-pnr-nr2e3-mab-clone-h7223-41202412505322.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")