![Immunocytochemistry/Immunofluorescence: EYS/RP25 Antibody [NBP1-90038] - Wild-type & pomgnt1sny7 mutant retinas: EYS/RP25 (green) & acetylated alpha-tubulin (red). (A,E) Wild-type retina 2-mpf. (C,G) Wild-type retina 6-mpf. (B, F) Homozygous pomgnt1sny7 mutant retina 2-mpf. (D,H) Homozygous pomgnt1sny7 mutant retina 6-mpf. (I,J) Counting EYS-acetylated alpha-tubulin from outer nuclear layer to retinal pigment epithelium (RPE) 2-mpf and 6-mpf retina. (K,L) Ratio of EYS/RP25 & acetylated alpha-tubulin-labeled axonemes in rods & cones 2-mpf (M,N). Ratio of EYS/RP25 and acetylated alpha-tubulin acetylated alpha-tubulin-labeled axoneme in rods & cones 6-mpf (O,Q). Total EYS/RP25 immunoreactivity 2-mpf & 6-mpf. (P,R) Total EYS/RP25 in wild-type/heterozygous & mutant fish 2-mpf, 6-mpf. Scale bar: 5 um (A-D); 2.5 um (E-H). Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-020-64752-4), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/EYS-RP25-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90038-img0005.jpg "Immunocytochemistry/Immunofluorescence: EYS/RP25 Antibody [NBP1-90038] - Wild-type & pomgnt1sny7 mutant retinas: EYS/RP25 (green) & acetylated alpha-tubulin (red). (A,E) Wild-type retina 2-mpf. (C,G) Wild-type retina 6-mpf. (B, F) Homozygous pomgnt1sny7 mutant retina 2-mpf. (D,H) Homozygous pomgnt1sny7 mutant retina 6-mpf. (I,J) Counting EYS-acetylated alpha-tubulin from outer nuclear layer to retinal pigment epithelium (RPE) 2-mpf and 6-mpf retina. (K,L) Ratio of EYS/RP25 & acetylated alpha-tubulin-labeled axonemes in rods & cones 2-mpf (M,N). Ratio of EYS/RP25 and acetylated alpha-tubulin acetylated alpha-tubulin-labeled axoneme in rods & cones 6-mpf (O,Q). Total EYS/RP25 immunoreactivity 2-mpf & 6-mpf. (P,R) Total EYS/RP25 in wild-type/heterozygous & mutant fish 2-mpf, 6-mpf. Scale bar: 5 um (A-D); 2.5 um (E-H). Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-020-64752-4), licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EYS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EYS |
![Immunohistochemistry-Paraffin: EYS/RP25 Antibody [NBP1-90038] - Staining of human lung shows moderate cytoplasmic positivity in lung macrophages.](http://images.novusbio.com/fullsize/EYS-RP25-Antibody-Immunohistochemistry-Paraffin-NBP1-90038-img0004.jpg "Immunohistochemistry-Paraffin: EYS/RP25 Antibody [NBP1-90038] - Staining of human lung shows moderate cytoplasmic positivity in lung macrophages.")
![Immunocytochemistry/ Immunofluorescence: EYS/RP25 Antibody [NBP1-90038] - Immunohistochemistry on retinal sections of wild-type & eysrmc101/rmc101 zebrafish.(A) Retinal sections of wild-type & eysrmc101/rmc101 zebrafish at 5 dpf & 5 mpf stained with antibodies against Eys (green) & centrin (red). (B) BODIPY (green) staining showing disorganization of photoreceptor outer segments in eysrmc101/rmc101 zebrafish (5 dpf & 5 mpf) compared to age- & strain-matched wild-type zebrafish (arrows). (C) Retinal sections of wild-type & eysrmc101/rmc101 zebrafish at 5 dpf (upper panel), 2 mpf (middle panel) & 5 mpf (lower panel) stained with antibodies against rhodopsin (green) & F-actin (red). Asterisks indicate mislocalization of rhodopsin to the inner segments & synapses of photoreceptor cells. (D) Retinal sections of wild-type & eysrmc101/rmc101 zebrafish at 5 dpf, 2 mpf & 5 mpf stained with antibodies against GNAT2 (green) & F-actin (red). Arrows indicate dysmorphic outer segments in mutant zebrafish. In all images, nuclei are counterstained with DAPI (blue). INL: inner nuclear layer; ONL: outer nuclear layer; OS: outer segments. Scale: 5 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30052645), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-90038_rabbit-polyclonal-eys-rp25-antibody-31020241613627.jpg "Immunocytochemistry/ Immunofluorescence: EYS/RP25 Antibody [NBP1-90038] - Immunohistochemistry on retinal sections of wild-type & eysrmc101/rmc101 zebrafish.(A) Retinal sections of wild-type & eysrmc101/rmc101 zebrafish at 5 dpf & 5 mpf stained with antibodies against Eys (green) & centrin (red). (B) BODIPY (green) staining showing disorganization of photoreceptor outer segments in eysrmc101/rmc101 zebrafish (5 dpf & 5 mpf) compared to age- & strain-matched wild-type zebrafish (arrows). (C) Retinal sections of wild-type & eysrmc101/rmc101 zebrafish at 5 dpf (upper panel), 2 mpf (middle panel) & 5 mpf (lower panel) stained with antibodies against rhodopsin (green) & F-actin (red). Asterisks indicate mislocalization of rhodopsin to the inner segments & synapses of photoreceptor cells. (D) Retinal sections of wild-type & eysrmc101/rmc101 zebrafish at 5 dpf, 2 mpf & 5 mpf stained with antibodies against GNAT2 (green) & F-actin (red). Arrows indicate dysmorphic outer segments in mutant zebrafish. In all images, nuclei are counterstained with DAPI (blue). INL: inner nuclear layer; ONL: outer nuclear layer; OS: outer segments. Scale: 5 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30052645), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: EYS/RP25 Antibody [NBP1-90038] - Mislocalized EYS in pomgnt1 mutant zebrafish retina was co-localized with synaptogamin-1. Retinal sections from 2-mpf zebrafish were double stained with antibodies against EYS (red fluorescence) & synaptotagmin-1 (green fluorescence). (A) Wild-type inner/outer segment layers showing connecting cilia (CC). Maximal projection & its orthogonal views of three double stained puncta are shown. EYS-immunoreactivity was co-localized with synaptagmin-1 reactivity. (B) Wild-type outer nuclear layer (ONL). Maximal projection & its orthogonal views of two double stained puncta are shown. EYS-immunoreactivity was co-localized with synaptagmin-1 reactivity. (C) Homozygous pomgnt1sny7 mutant outer nuclear layer. Maximal projection & its orthogonal views of three double stained puncta are shown. Mislocalized EYS immunoreactive puncta was co-localized with synaptotagmin-1 reactivity. Scale bar in C: 2 µm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32385361), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-90038_rabbit-polyclonal-eys-rp25-antibody-31020241612231.jpg "Immunocytochemistry/ Immunofluorescence: EYS/RP25 Antibody [NBP1-90038] - Mislocalized EYS in pomgnt1 mutant zebrafish retina was co-localized with synaptogamin-1. Retinal sections from 2-mpf zebrafish were double stained with antibodies against EYS (red fluorescence) & synaptotagmin-1 (green fluorescence). (A) Wild-type inner/outer segment layers showing connecting cilia (CC). Maximal projection & its orthogonal views of three double stained puncta are shown. EYS-immunoreactivity was co-localized with synaptagmin-1 reactivity. (B) Wild-type outer nuclear layer (ONL). Maximal projection & its orthogonal views of two double stained puncta are shown. EYS-immunoreactivity was co-localized with synaptagmin-1 reactivity. (C) Homozygous pomgnt1sny7 mutant outer nuclear layer. Maximal projection & its orthogonal views of three double stained puncta are shown. Mislocalized EYS immunoreactive puncta was co-localized with synaptotagmin-1 reactivity. Scale bar in C: 2 µm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32385361), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence PNR/NR2E3 Antibody (H7223) [Unconjugated]](https://images.novusbio.com/images/pp-h7223-00_human-pnr-nr2e3-mab-clone-h7223-41202412514869.jpg)
![Immunocytochemistry/ Immunofluorescence PNR/NR2E3 Antibody (H7223) [Unconjugated]](https://images.novusbio.com/images/pp-h7223-00_human-pnr-nr2e3-mab-clone-h7223-41202412505322.jpg)
![Flow Cytometry Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Flow_Cytometry_12100.jpg)
![Immunohistochemistry Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Immunohistochemistry_22755.jpg)
![Dual RNAscope ISH-IHC Compatible Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Dual_RNAscope_ISHIHC_23834.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Agrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Agrin [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")