Home » PACT » PACT Proteins » PACT Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PACT Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PACT Recombinant Protein Antigen (NBP2-55124PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PACT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to PACT.

Source: E. coli

Amino Acid Sequence: KLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKRA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55124.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PACT Recombinant Protein Antigen

  • DYT16
  • DYT16interferon-inducible double stranded RNA-dependent activator
  • HSD14
  • PACT
  • PACTPKR-associating protein X
  • PKR-associated protein X
  • PKR-Associating Protein X
  • PRKRA
  • protein kinase, interferon-inducible double stranded RNA dependent activator
  • RAX
  • RAXHSD14

Background

PACT encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PKR Antibody - BSA
Free
NBP1-77266
Western Blot PKR Antibody - BSA Free
Western Blot PKR Antibody - BSA Free
Immunohistochemistry PKR Antibody - BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PKLR Antibody
[Unconjugated]
AF8519
Western Blot PKLR Antibody [Unconjugated]
Simple Western PKLR Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: Simple Western, WB
TRBP Antibody
NBP2-24725
Western Blot TRBP Antibody
Immunohistochemistry-Paraffin TRBP Antibody
Immunohistochemistry-Paraffin TRBP Antibody
(1 Publication)
Species: Eq, Hu, Pm
Applications: IHC, IHC-P, WB
Torsin A Antibody
- BSA Free
NBP3-03780
Immunohistochemistry-Paraffin Torsin A Antibody - BSA Free
Immunohistochemistry-Paraffin Torsin A Antibody - BSA Free
Western Blot Torsin A Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NCOA6 Antibody
NB200-335
Western Blot NCOA6 Antibody
Immunohistochemistry-Paraffin NCOA6 Antibody
Immunoprecipitation NCOA6 Antibody
(8 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
Dicer Antibody -
BSA Free
NBP1-71691
Immunocytochemistry/ Immunofluorescence Dicer Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Dicer Antibody - BSA Free
Immunohistochemistry Dicer Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
RBBP6 Antibody -
BSA Free
NBP1-49535
Western Blot RBBP6 Antibody - BSA Free
Immunohistochemistry-Paraffin RBBP6 Antibody - BSA Free
Immunohistochemistry-Paraffin RBBP6 Antibody - BSA Free
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
THAP1 Antibody
H00055145-D01P
Western Blot THAP1 Antibody
Western Blot THAP1 Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, WB
Otx2 Antibody
[Unconjugated]
AF1979
Immunocytochemistry Otx2 Antibody [Unconjugated]
Immunohistochemistry Otx2 Antibody [Unconjugated]
Simple Western Otx2 Antibody [Unconjugated]
(2 Reviews)
(177 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Pax6 Antibody
[Unconjugated]
AF8150
Simple Western Pax6 Antibody [Unconjugated]
Immunocytochemistry Pax6 Antibody [Unconjugated]
Western Blot Pax6 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB

epsilon-Sarcoglycan An
NBP1-59794
Immunohistochemistry epsilon-Sarcoglycan Antibody
Western Blot epsilon-Sarcoglycan Antibody
Western Blot epsilon-Sarcoglycan Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Sodium Potassium
ATPase Alpha 3 Antibo ...
NB300-540
Immunocytochemistry/ Immunofluorescence Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) - BSA Free
Immunocytochemistry/ Immunofluorescence Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) - BSA Free
Immunocytochemistry/ Immunofluorescence Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) - BSA Free
(2 Reviews)
(21 Publications)
Species: Bv, Ca, Gp, Hu, Mu, Pm, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, Single-Cell Western, WB
Glut1 Antibody -
BSA Free
NB110-39113
Western Blot Glut1 Antibody - BSA Free
Flow Cytometry Glut1 Antibody - BSA Free
Western Blot Glut1 Antibody - BSA Free
(7 Reviews)
(62 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
GCH1 Antibody
NBP1-84949
Immunohistochemistry-Paraffin GCH1 Antibody
Immunohistochemistry-Paraffin GCH1 Antibody
Immunohistochemistry-Paraffin GCH1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CHX10 Antibody
NBP1-84476
Immunohistochemistry-Paraffin CHX10 Antibody
Immunohistochemistry-Paraffin CHX10 Antibody
Western Blot CHX10 Antibody
(8 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(232 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB

Publications for PACT Recombinant Protein Antigen (NBP2-55124PEP) (0)

There are no publications for PACT Recombinant Protein Antigen (NBP2-55124PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PACT Recombinant Protein Antigen (NBP2-55124PEP) (0)

There are no reviews for PACT Recombinant Protein Antigen (NBP2-55124PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PACT Recombinant Protein Antigen (NBP2-55124PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PACT Products

Research Areas for PACT Recombinant Protein Antigen (NBP2-55124PEP)

Find related products by research area.

Blogs on PACT

There are no specific blogs for PACT, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Tyrosine Hydroxylase Antibody
NB300-109
Otx2 was detected in immersion fixed NTera-2 human testicular embryonic carcinoma cell line using Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Otx2 Antibody [Unconjugated]
AF1979

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PACT Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PRKRA