![Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Western blot analysis of extracts of various cell lines, using PA2G4/EBP1Rabbit mAb (NBP3-16561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.](http://images.novusbio.com/fullsize/PA2G4-EBP1-Antibody-9J9U5-Western-Blot-NBP3-16561-img0005.jpg "Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Western blot analysis of extracts of various cell lines, using PA2G4/EBP1Rabbit mAb (NBP3-16561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 9J9U5 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-394 of human PA2G4/EBP1 (NP_006182.2). ELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | PA2G4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Neutralization ErbB3/Her3 Antibody (66223) [Unconjugated]](https://images.novusbio.com/images2/ErbB3_MAB3481_Block_Neutralize_9158.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PA2G4/EBP1 Antibody (NBP3-16561)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PA2G4 |
![Immunocytochemistry/Immunofluorescence: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunofluorescence analysis of NIH-3T3 cells using PA2G4/EBP1Rabbit mAb (NBP3-16561) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PA2G4-EBP1-Antibody-9J9U5-Immunocytochemistry-Immunofluorescence-NBP3-16561-img0004.jpg "Immunocytochemistry/Immunofluorescence: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunofluorescence analysis of NIH-3T3 cells using PA2G4/EBP1Rabbit mAb (NBP3-16561) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunohistochemistry of paraffin-embedded mouse kidney using PA2G4/EBP1Rabbit mAb (NBP3-16561) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/PA2G4-EBP1-Antibody-9J9U5-Immunohistochemistry-Paraffin-NBP3-16561-img0003.jpg "Immunohistochemistry-Paraffin: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunohistochemistry of paraffin-embedded mouse kidney using PA2G4/EBP1Rabbit mAb (NBP3-16561) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Western blot analysis of extracts of Rat brain, using PA2G4/EBP1Rabbit mAb (NBP3-16561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/PA2G4-EBP1-Antibody-9J9U5-Western-Blot-NBP3-16561-img0006.jpg "Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Western blot analysis of extracts of Rat brain, using PA2G4/EBP1Rabbit mAb (NBP3-16561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
![Immunohistochemistry-Paraffin: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunohistochemistry of paraffin-embedded rat testis using PA2G4/EBP1Rabbit mAb (NBP3-16561) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/PA2G4-EBP1-Antibody-9J9U5-Immunohistochemistry-Paraffin-NBP3-16561-img0001.jpg "Immunohistochemistry-Paraffin: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunohistochemistry of paraffin-embedded rat testis using PA2G4/EBP1Rabbit mAb (NBP3-16561) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunohistochemistry of paraffin-embedded human colon carcinoma using PA2G4/EBP1Rabbit mAb (NBP3-16561) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/PA2G4-EBP1-Antibody-9J9U5-Immunohistochemistry-Paraffin-NBP3-16561-img0002.jpg "Immunohistochemistry-Paraffin: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunohistochemistry of paraffin-embedded human colon carcinoma using PA2G4/EBP1Rabbit mAb (NBP3-16561) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")