![Western Blot: CDK20 Antibody [NBP1-91214] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/CDK20-Antibody-Western-Blot-NBP1-91214-img0007.jpg "Western Blot: CDK20 Antibody [NBP1-91214] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDK20 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
| Publication using NBP1-91214 | Applications | Species |
|---|---|---|
| Ashraf S, Kudo H, Rao J et al. Mutations in six nephrosis genes delineate a pathogenic pathway amenable to treatment Nat Commun 2018-05-17 [PMID: 29773874] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for CDK20 Antibody (NBP1-91214)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDK20 |
![Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CDK20-Antibody-Immunohistochemistry-Paraffin-NBP1-91214-img0013.jpg "Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.")
![Western Blot: CDK20 Antibody [NBP1-91214] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/CDK20-Antibody-Western-Blot-NBP1-91214-img0006.jpg "Western Blot: CDK20 Antibody [NBP1-91214] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/CDK20-Antibody-Immunohistochemistry-Paraffin-NBP1-91214-img0009.jpg "Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining in human fallopian tube and skeletal muscle tissues using anti-CDK20 antibody. Corresponding CDK20 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CDK20-Antibody-Immunohistochemistry-Paraffin-NBP1-91214-img0010.jpg "Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining in human fallopian tube and skeletal muscle tissues using anti-CDK20 antibody. Corresponding CDK20 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding CDK20 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CDK20-Antibody-Immunohistochemistry-Paraffin-NBP1-91214-img0011.jpg "Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding CDK20 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human duodenum shows weak cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CDK20-Antibody-Immunohistochemistry-Paraffin-NBP1-91214-img0012.jpg "Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human duodenum shows weak cytoplasmic positivity in glandular cells.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Immunocytochemistry__Immunofluorescence_21057.jpg)
![Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Simple_Western_16621.jpg)
![Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Western_Blot_12767.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")