p53R2 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
RRM2B |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for p53R2 Antibody
Background
The p53 tumor-suppressor gene integrates numerous signals that control cell life and death. Several novel molecules involved in p53 signaling, including p53R2, Chk2, p53AIP1, Noxa, PIDD, and PID/MTA2, were recently discovered. p53R2 is a p53 inducible gene that contains a p53 binding sequence and encodes a subunit of the enzyme ribonucleotide reductase. p53R2 is induced by the reagents, ultraviolet and g-irradiation that cause DNA damages. The product of p53R2 gene is directly involved in the p53 checkpoint for repair of damaged DNA. The isoform of the p53 family member p73 also induces p53R2 expression. p53R2 is an important target of p53 for tumour suppression.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC, IHC-P, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: DirELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ICC/IF, IHC
Publications for p53R2 Antibody (NBP1-87368) (0)
There are no publications for p53R2 Antibody (NBP1-87368).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for p53R2 Antibody (NBP1-87368) (0)
There are no reviews for p53R2 Antibody (NBP1-87368).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for p53R2 Antibody (NBP1-87368) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional p53R2 Products
Research Areas for p53R2 Antibody (NBP1-87368)
Find related products by research area.
|
Blogs on p53R2