![Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human colon, kidney, liver and testis using Anti-p107 antibody NBP2-33735 (A) shows similar protein distribution across tissues to independent antibody NBP2-33791 (B).](http://images.novusbio.com/fullsize/p107-Antibody-Immunohistochemistry-Paraffin-NBP2-33735-img0014.jpg "Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human colon, kidney, liver and testis using Anti-p107 antibody NBP2-33735 (A) shows similar protein distribution across tissues to independent antibody NBP2-33791 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHER |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RBL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-33735 | Applications | Species |
|---|---|---|
| Baek HB, Lombard AP, Libertini SJ et al. XPO1 inhibition by selinexor induces potent cytotoxicity against high grade bladder malignancies. Oncotarget. 2018-10-02 [PMID: 30349650] (WB, ICC/IF, Human) | WB, ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for p107 Antibody (NBP2-33735)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: p107 Antibody [NBP2-33735] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/p107-Antibody-Western-Blot-NBP2-33735-img0006.jpg "Western Blot: p107 Antibody [NBP2-33735] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunocytochemistry/Immunofluorescence: p107 Antibody [NBP2-33735] - Selinexor alters pocket protein expression in nuclear and cytoplasmic compartments. Representative images of p107, p130 and RB (green) IF staining of bladder cancer cells treated with vehicle (V) or selinexor (S) for 48 hours. Tubulin staining (red) and DAPI staining (blue) served to define the cytoplasmic and nuclear compartments, respectively. The inserts are magnifications of the boxed cells. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/26179), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/p107-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33735-img0015.jpg "Immunocytochemistry/Immunofluorescence: p107 Antibody [NBP2-33735] - Selinexor alters pocket protein expression in nuclear and cytoplasmic compartments. Representative images of p107, p130 and RB (green) IF staining of bladder cancer cells treated with vehicle (V) or selinexor (S) for 48 hours. Tubulin staining (red) and DAPI staining (blue) served to define the cytoplasmic and nuclear compartments, respectively. The inserts are magnifications of the boxed cells. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/26179), licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: p107 Antibody [NBP2-33735] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/p107-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33735-img0007.jpg "Immunocytochemistry/Immunofluorescence: p107 Antibody [NBP2-33735] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human testis shows moderate nuclear postivity in cells in seminiferous ducts and Leydig cells.](http://images.novusbio.com/fullsize/p107-Antibody-Immunohistochemistry-Paraffin-NBP2-33735-img0010.jpg "Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human testis shows moderate nuclear postivity in cells in seminiferous ducts and Leydig cells.")
![Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human colon shows moderate nuclear positivity in glanular cells.](http://images.novusbio.com/fullsize/p107-Antibody-Immunohistochemistry-Paraffin-NBP2-33735-img0011.jpg "Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human colon shows moderate nuclear positivity in glanular cells.")
![Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human kidney shows moderate nuclear postivity in cells in tubules.](http://images.novusbio.com/fullsize/p107-Antibody-Immunohistochemistry-Paraffin-NBP2-33735-img0012.jpg "Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human kidney shows moderate nuclear postivity in cells in tubules.")
![Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/p107-Antibody-Immunohistochemistry-Paraffin-NBP2-33735-img0013.jpg "Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")