Independent Antibodies: Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human colon, kidney, liver and testis using Anti-p107 antibody NBP2-33735 (A) shows similar protein distribution ...read more
Western Blot: p107 Antibody [NBP2-33735] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: p107 Antibody [NBP2-33735] - Selinexor alters pocket protein expression in nuclear and cytoplasmic compartments. Representative images of p107, p130 and RB (green) IF staining of ...read more
Immunocytochemistry/ Immunofluorescence: p107 Antibody [NBP2-33735] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human testis shows moderate nuclear postivity in cells in seminiferous ducts and Leydig cells.
Independent Antibodies: Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human colon shows moderate nuclear positivity in glanular cells.
Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human kidney shows moderate nuclear postivity in cells in tubules.
Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human liver shows no positivity in hepatocytes as expected.
This antibody was developed against a recombinant protein corresponding to amino acids: ESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHER
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for p107 Antibody
cellular protein 107,107 kDa retinoblastoma-associated protein
cp107
p107MGC40006
PRB1
retinoblastoma-like 1 (p107)
retinoblastoma-like protein 1
Background
p107, also known as Retinoblastoma-like protein 1, consists of a 121 kDa 1068 and 115 kDa 1014 isoform. The primary function of p107 is to encode a gene that plays a crutial role in regulating entry into cell division. Current research on p107 is being conducted in relation to carcinoma, cholangiocarcinoma, osteosarcoma, lung cancer, prostate cancer, breast cancer, endometrial cancer, glioblastoma, burkitt's lymphoma, myeloid leukemia and cervicitis. p107 is linked to the cell cycle, transcription, s phase, senescence and DNA replication pathways where it interacts with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D and HIST1H4E.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our p107 Antibody and receive a gift card or discount.