ORC3L Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKD |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ORC3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for ORC3L Antibody
Background
ORC3L is involved in DNA replication origin binding.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Publications for ORC3L Antibody (NBP2-55490) (0)
There are no publications for ORC3L Antibody (NBP2-55490).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ORC3L Antibody (NBP2-55490) (0)
There are no reviews for ORC3L Antibody (NBP2-55490).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ORC3L Antibody (NBP2-55490) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ORC3L Products
Blogs on ORC3L