Novus Biologicals products are now on bio-techne.com

OPA1 Recombinant Protein Antigen

Images

 
There are currently no images for OPA1 Recombinant Protein Antigen (NBP2-48669PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

OPA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OPA1

Source: E. coli

Amino Acid Sequence: ESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OPA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48669.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OPA1 Recombinant Protein Antigen

  • BERHS
  • EC 3.6.5.5
  • FLJ12460
  • KIAA0567dynamin-like 120 kDa protein, mitochondrial
  • LargeG
  • lilr3
  • MGM1
  • mitochondrial dynamin-like GTPase
  • MTDPS14
  • NPG
  • NPGlargeG
  • NTG
  • NTGmitochondrial dynamin-like 120 kDa protein
  • OPA1
  • optic atrophy 1 (autosomal dominant)
  • Optic atrophy protein 1

Background

OPA1 product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Highly expressed in the retina, OPA1 mutations have been associated with a dominantly inherited optic neuropathy, called optic atrophy type 1, resulting in progressive loss of visual acuity. Eight transcript variants encoding different isoforms, resulting from alternative splicing of exon 4 and two novel exons named 4b and 5b, have been reported for this gene.

OPA1 antibodies are used primarily for vision research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55288
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00009927-M03
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, RNAi, WB
H00055669-M04
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IP, KD, WB
H00007402-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-16148
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02477
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-76651
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-85664
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-80878
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92221
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC, IHC-P, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NBP2-01860
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3470
Species: Hu
Applications: ICC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-48669PEP
Species: Hu
Applications: AC

Publications for OPA1 Recombinant Protein Antigen (NBP2-48669PEP) (0)

There are no publications for OPA1 Recombinant Protein Antigen (NBP2-48669PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OPA1 Recombinant Protein Antigen (NBP2-48669PEP) (0)

There are no reviews for OPA1 Recombinant Protein Antigen (NBP2-48669PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OPA1 Recombinant Protein Antigen (NBP2-48669PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OPA1 Products

Research Areas for OPA1 Recombinant Protein Antigen (NBP2-48669PEP)

Find related products by research area.

Blogs on OPA1.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

BNIP3 - a regulator of mitochondrial autophagy and cell death
Bcl-2 nineteen-kilodalton interacting protein 3 (BNIP3) is a pro-apoptotic BH3-only protein. BNIP3 localizes to the mitochondrial membrane where it plays a key role in mitochondrial autophagy and cell death pathways. Similar to other Bcl-2 family m...  Read full blog post.

Understanding OPA1 and Mitochondrial Function
OPA1 belongs to the Dynamin large GTPase protein family. OPA1 exists as a single-pass membrane protein localized in the mitochondrial inner membrane and also as a soluble form in the mitochondrial intermembrane space. There, it is a key player in fusi...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OPA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OPA1