Novus Biologicals products are now on bio-techne.com

Recombinant Human OCT4 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human OCT4 Protein [H00005460-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Recombinant Human OCT4 GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-164 of Human POU5F1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
POU5F1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
44.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OCT4 GST (N-Term) Protein

  • class 5, transcription factor 1
  • MGC22487
  • Oct-3
  • OCT3Oct4
  • Oct-4
  • Octamer-binding protein 3
  • otc-4
  • OTF3POU domain class 5, transcription factor 1
  • OTF4
  • POU class 5 homeobox 1
  • POU-type homeodomain-containing DNA-binding protein

Background

The transcription factor OCT4, expressed in ESCs and germ cells, is strongly implicated in the process of maintaining as well as regaining stem-cell pluripotency and functions as a key regulator of mammalian germline development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1997
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
H00388112-B01P
Species: Hu
Applications: WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF3158
Species: Mu
Applications: ChIP, ICC, IHC, WB
7734-LF
Species: Hu
Applications: BA
NBP2-37357
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
235-F4
Species: Hu
Applications: BA
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AF3757
Species: Hu
Applications: ICC, Simple Western, WB
NB120-16518
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
233-FB
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB

Publications for OCT4 Recombinant Protein (H00005460-P01) (0)

There are no publications for OCT4 Recombinant Protein (H00005460-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OCT4 Recombinant Protein (H00005460-P01) (0)

There are no reviews for OCT4 Recombinant Protein (H00005460-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OCT4 Recombinant Protein (H00005460-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OCT4 Products

Research Areas for OCT4 Recombinant Protein (H00005460-P01)

Find related products by research area.

Blogs on OCT4. Showing 1-10 of 11 blog posts - Show all blog posts.

Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness
By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax...  Read full blog post.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate
Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu...  Read full blog post.

Stemness for Surviving Hypoxia: TGF-beta/Smad Signaling in Multiple Myeloma
By Jamshed Arslan Pharm.D. Multiple myeloma (MM) is a cancer of antibody-producing plasma cells. The bone marrow (BM) of MM patients is hypoxic, and MM cells overexpress many cancerous genes that are regulated by hy...  Read full blog post.

Nanog is a Master Controller of ES cell Pluripotency
Nanog, a homeodomain (HD) transcription factor, plays a critical role in the maintenance of embryonic stem (ES) cell self-renewal. Transcription regulator involved in inner cell mass and ES cell proliferation and self-renewal. Imposes pluripotency on ...  Read full blog post.

Histones, Bmi1 & OCT4: Investigating the Secrets of ESC Pluripotency
Epigenetic alterations have come to prominence in biomedical research. In particular, hypermethylation of CpG islands located in the promoter regions of tumor-suppressor genes is now firmly established as an important mechanism for gene inactivation i...  Read full blog post.

Sox2 and Oct4: Roles in Embryonic Stem Cell Pluripotency
Embryonic stem (ES) cells are cells derived from the inner cell mass of the blastocyst, an early-stage embryo. ES cells are distinguished from other cells due to their pluripotency, which is the ability to differentiate into any different type of cell...  Read full blog post.

An Unlikely Pairing: The SOX2 Antibody and Breast Cancer
SOX2 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors, which play a vital role in embryonic development. SOX2 antibody research has identified Sox2 as a key transcription factor in pluripotent stem cells. We at Novus B...  Read full blog post.

The Sox2 Antibody Aids Brain Cancer Research
The Sox2 antibody is widely used in sensory, neuroscience and stem cell marker research. Recently, Sox2 antibody preparations identified the Sox2 protein as a marker for malignant neural gliomas. We at Novus Biologicals offer a wide variety of highly ...  Read full blog post.

Not as Pluripotent as You Used to Be: Embryonic Stem Cell Markers and the Aging Process
We at Novus Biologicals recently extended our antibody catalog to include several embryonic stem cells (ESC) antibodies validated for use in FACS (fluorescent activated cell sorting) assays. Among them was Oct4, which recently became the focus of an i...  Read full blog post.

Showing 1-10 of 11 blog posts - Show all blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OCT4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POU5F1