![Western Blot: NuMA Antibody (1C5) [H00004926-M01] - NUMA1 monoclonal antibody (M01), clone 1C5 Analysis of NUMA1 expression in K-562.](http://images.novusbio.com/fullsize/NuMA-Antibody-1C5-Western-Blot-H00004926-M01-img0006.jpg "Western Blot: NuMA Antibody (1C5) [H00004926-M01] - NUMA1 monoclonal antibody (M01), clone 1C5 Analysis of NUMA1 expression in K-562.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IP |
| Clone | 1C5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | NUMA1 (NP_006176, 200 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQDLKTEK |
| Localization | Nuclear |
| Specificity | NUMA1 - nuclear mitotic apparatus protein 1 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | NUMA1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/16321.jpg)
![Knockout Validated STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Knockout_Validated_21968.jpg)
![Immunocytochemistry STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Immunocytochemistry__Immunofluorescence_17603.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for NuMA Antibody (H00004926-M01)Find related products by research area.
|
|
NuMA: The Key to Asymmetric Cell Division Nuclear Mitotic Apparatus protein (NuMA) is a cell cycle-related protein that acts as an organizer of the mitotic spindle during mitosis. It may be involved in coordinating the alignment of the mitotic spindle to the cellular polarity axis, which is a... Read full blog post. |
|
Nucleus and Mitotic Apparatus (NuMA) Protein in Cell Cycle Regulation NuMA, the major protein of the "Nucleus and Mitotic Apparatus", is a structural protein in vertebrates involved in cell cycle regulation. It localizes to the nucleus during interphase, and accumulates at the spindle poles during mitosis and NuMA has b... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: NuMA Antibody (1C5) [H00004926-M01] - Immunofluorescence of monoclonal antibody to NUMA1 on HeLa cell . [antibody concentration 10 ug/ml]](http://images.novusbio.com/fullsize/NuMA-Antibody-1C5-Immunocytochemistry-Immunofluorescence-H00004926-M01-img0002.jpg "Immunocytochemistry/Immunofluorescence: NuMA Antibody (1C5) [H00004926-M01] - Immunofluorescence of monoclonal antibody to NUMA1 on HeLa cell . [antibody concentration 10 ug/ml]")
![Immunoprecipitation: NuMA Antibody (1C5) [H00004926-M01] - Analysis of NUMA1 transfected lysate using anti-NUMA1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NUMA1 MaxPab rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/NuMA-Antibody-1C5-Immunoprecipitation-H00004926-M01-img0004.jpg "Immunoprecipitation: NuMA Antibody (1C5) [H00004926-M01] - Analysis of NUMA1 transfected lysate using anti-NUMA1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NUMA1 MaxPab rabbit polyclonal antibody.")
![ELISA: NuMA Antibody (1C5) [H00004926-M01] - Detection limit for recombinant GST tagged NUMA1 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/NuMA-Antibody-1C5-ELISA-H00004926-M01-img0005.jpg "ELISA: NuMA Antibody (1C5) [H00004926-M01] - Detection limit for recombinant GST tagged NUMA1 is approximately 0.1ng/ml as a capture antibody.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot PLZF Antibody [Unconjugated]](https://images.novusbio.com/images2/PLZF_AF2944_Western_Blot_5229.jpg)
![Simple Western PLZF Antibody [Unconjugated]](https://images.novusbio.com/images2/PLZF_AF2944_Simple_Western_16989.jpg)
![Western Blot PLZF Antibody [Unconjugated]](https://images.novusbio.com/images/af2944_human-plzf-affinity-purified-polyclonal-ab-41202412394950.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")