![Western Blot: NeuroD1 Antibody [NBP1-88661] - Analysis in control (vector only transfected HEK293T lysate) and NEUROD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/NeuroD1-Antibody-Western-Blot-NBP1-88661-img0006.jpg "Western Blot: NeuroD1 Antibody [NBP1-88661] - Analysis in control (vector only transfected HEK293T lysate) and NEUROD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL |
| Predicted Species | Mouse (98%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NEUROD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NeuroD1 Antibody (NBP1-88661)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NEUROD1 |
![Western Blot: NeuroD1 Antibody [NBP1-88661] - Example of the positive control of the four key molecules by WB in SCLC cell lines. NeuroD1 was strongly expressed in H82 cells. Beta-actin served as an internal control. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33202998/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/nbp1-88661_rabbit-polyclonal-neurod1-antibody-20920231412573.jpg "Western Blot: NeuroD1 Antibody [NBP1-88661] - Example of the positive control of the four key molecules by WB in SCLC cell lines. NeuroD1 was strongly expressed in H82 cells. Beta-actin served as an internal control. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33202998/) licensed under a CC-BY license.")
![Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - Example of the positive control of the four key molecules in xenotransplanted tumor tissues from the four cell lines in mice by IHC. NeuroD1 staining was found in the tumor cell nuclei of H82 cells. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33202998/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/nbp1-88661_rabbit-polyclonal-neurod1-antibody-2092023181150.jpg "Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - Example of the positive control of the four key molecules in xenotransplanted tumor tissues from the four cell lines in mice by IHC. NeuroD1 staining was found in the tumor cell nuclei of H82 cells. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33202998/) licensed under a CC-BY license.")
![Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - IHC of the co-expression of key molecules other than ASCL1 in SCLC samples. Serial section immunostaining for NEUROD1 (A) & YAP1 (B): SCLC cell nuclei were positive for NEUROD1 (A), & the cytoplasm was positive for YAP1 (B). Serial section immunostaining for NEUROD1 (C) & POU2F31 (D): SCLC cell nuclei were positive for NEUROD1 (C), & the cytoplasm was positive for POU2F3 (D). The cytoplasm of SCLC cells was positive for YAP1 (E) & POU2F3 (F). Scale bar = 100 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88661_rabbit-polyclonal-neurod1-antibody-310202415395953.jpg "Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - IHC of the co-expression of key molecules other than ASCL1 in SCLC samples. Serial section immunostaining for NEUROD1 (A) & YAP1 (B): SCLC cell nuclei were positive for NEUROD1 (A), & the cytoplasm was positive for YAP1 (B). Serial section immunostaining for NEUROD1 (C) & POU2F31 (D): SCLC cell nuclei were positive for NEUROD1 (C), & the cytoplasm was positive for POU2F3 (D). The cytoplasm of SCLC cells was positive for YAP1 (E) & POU2F3 (F). Scale bar = 100 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - IHC of the co-expression of key molecules other than ASCL1 in SCLC samples. Serial section immunostaining for NEUROD1 (A) & YAP1 (B): SCLC cell nuclei were positive for NEUROD1 (A), & the cytoplasm was positive for YAP1 (B). Serial section immunostaining for NEUROD1 (C) & POU2F31 (D): SCLC cell nuclei were positive for NEUROD1 (C), & the cytoplasm was positive for POU2F3 (D). The cytoplasm of SCLC cells was positive for YAP1 (E) & POU2F3 (F). Scale bar = 100 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88661_rabbit-polyclonal-neurod1-antibody-31020241534377.jpg "Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - IHC of the co-expression of key molecules other than ASCL1 in SCLC samples. Serial section immunostaining for NEUROD1 (A) & YAP1 (B): SCLC cell nuclei were positive for NEUROD1 (A), & the cytoplasm was positive for YAP1 (B). Serial section immunostaining for NEUROD1 (C) & POU2F31 (D): SCLC cell nuclei were positive for NEUROD1 (C), & the cytoplasm was positive for POU2F3 (D). The cytoplasm of SCLC cells was positive for YAP1 (E) & POU2F3 (F). Scale bar = 100 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - Example of the positive control of four key molecules by WB & IHC in SCLC samples. (A) Example of the positive control of the four key molecules by WB in SCLC cell lines. ASCL1 was strongly expressed in H209 cells. NeuroD1 was strongly expressed in H82 cells. Pou2F3 was strongly expressed in H526 cells & weakly expressed in H82 & SBC3 cells. YAP1 was strongly expressed in SBC3 cells. beta -actin served as an internal control. (B) Example of the positive control of the four key molecules in xenotransplanted tumor tissues from the four cell lines in mice by IHC. ASCL1 staining was found in tumor cell nuclei of H209 cells. NeuroD1 staining was found in the tumor cell nuclei of H82 cells. Pou2F3 staining with a diffuse cytoplasmic pattern was found in H82, H526, & SBC3 cells. The Pou2F3 staining intensity was weak in H82 & SBC3 cells & strong in H526 cells. YAP1 was stained with a membranous pattern in SBC3 cells. Scale bar = 50 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88661_rabbit-polyclonal-neurod1-antibody-310202416114786.jpg "Immunohistochemistry: NeuroD1 Antibody [NBP1-88661] - Example of the positive control of four key molecules by WB & IHC in SCLC samples. (A) Example of the positive control of the four key molecules by WB in SCLC cell lines. ASCL1 was strongly expressed in H209 cells. NeuroD1 was strongly expressed in H82 cells. Pou2F3 was strongly expressed in H526 cells & weakly expressed in H82 & SBC3 cells. YAP1 was strongly expressed in SBC3 cells. beta -actin served as an internal control. (B) Example of the positive control of the four key molecules in xenotransplanted tumor tissues from the four cell lines in mice by IHC. ASCL1 staining was found in tumor cell nuclei of H209 cells. NeuroD1 staining was found in the tumor cell nuclei of H82 cells. Pou2F3 staining with a diffuse cytoplasmic pattern was found in H82, H526, & SBC3 cells. The Pou2F3 staining intensity was weak in H82 & SBC3 cells & strong in H526 cells. YAP1 was stained with a membranous pattern in SBC3 cells. Scale bar = 50 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: NeuroD1 Antibody [NBP1-88661] - Example of the positive control of four key molecules by WB & IHC in SCLC samples. (A) Example of the positive control of the four key molecules by WB in SCLC cell lines. ASCL1 was strongly expressed in H209 cells. NeuroD1 was strongly expressed in H82 cells. Pou2F3 was strongly expressed in H526 cells & weakly expressed in H82 & SBC3 cells. YAP1 was strongly expressed in SBC3 cells. beta -actin served as an internal control. (B) Example of the positive control of the four key molecules in xenotransplanted tumor tissues from the four cell lines in mice by IHC. ASCL1 staining was found in tumor cell nuclei of H209 cells. NeuroD1 staining was found in the tumor cell nuclei of H82 cells. Pou2F3 staining with a diffuse cytoplasmic pattern was found in H82, H526, & SBC3 cells. The Pou2F3 staining intensity was weak in H82 & SBC3 cells & strong in H526 cells. YAP1 was stained with a membranous pattern in SBC3 cells. Scale bar = 50 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88661_rabbit-polyclonal-neurod1-antibody-310202416114787.jpg "Western Blot: NeuroD1 Antibody [NBP1-88661] - Example of the positive control of four key molecules by WB & IHC in SCLC samples. (A) Example of the positive control of the four key molecules by WB in SCLC cell lines. ASCL1 was strongly expressed in H209 cells. NeuroD1 was strongly expressed in H82 cells. Pou2F3 was strongly expressed in H526 cells & weakly expressed in H82 & SBC3 cells. YAP1 was strongly expressed in SBC3 cells. beta -actin served as an internal control. (B) Example of the positive control of the four key molecules in xenotransplanted tumor tissues from the four cell lines in mice by IHC. ASCL1 staining was found in tumor cell nuclei of H209 cells. NeuroD1 staining was found in the tumor cell nuclei of H82 cells. Pou2F3 staining with a diffuse cytoplasmic pattern was found in H82, H526, & SBC3 cells. The Pou2F3 staining intensity was weak in H82 & SBC3 cells & strong in H526 cells. YAP1 was stained with a membranous pattern in SBC3 cells. Scale bar = 50 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33202998), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX-1_AF2419_Western_Blot_5187.jpg)
![Immunocytochemistry PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX1_AF2419_Immunocytochemistry_16575.jpg)
![Simple Western PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX1_AF2419_Simple_Western_16996.jpg)
![Western Blot Neurogenin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogenin-3_AF3444_Western_Blot_5300.jpg)
![Immunohistochemistry Neurogenin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3444_human-neurogenin-3-affinity-purified-polyclonal-ab-immunohistochemistry-192021141921.jpg)
![Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2567_mouse-ascl1-mash1-affinity-purified-polyclonal-ab-immunohistochemistry-1732021122114.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Immunohistochemistry Neurogenin-2 Antibody (7G4) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3314_human-rat-neurogenin-2-mab-clone-7g4-285202411422.jpg)
![Immunohistochemistry Neurogenin-2 Antibody (7G4) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3314_human-rat-neurogenin-2-mab-clone-7g4-immunohistochemistry-285202411531..jpg)
![Simple Western Islet-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Islet1_AF1837_Simple_Western_21249.jpg)
![Western Blot Islet-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Islet1_AF1837_Western_Blot_21254.jpg)
![Immunocytochemistry Islet-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Islet1_AF1837_Immunocytochemistry__Immunofluorescence_17786.jpg)
![Immunocytochemistry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images2/Nestin_MAB1259_Immunocytochemistry_6561.jpg)
![Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1259_human-nestin-mab-clone-196908-intracellular-staining-by-flow-cytometry-24120239959.jpg)
![Western Blot Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/mab1259_human-nestin-mab-clone-196908-41202410481129.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")