![Immunohistochemistry-Paraffin: NDUFS2 Antibody [NBP2-30413] - Staining in human heart muscle and pancreas tissues using anti-NDUFS2 antibody. Corresponding NDUFS2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NDUFS2-Antibody-Immunohistochemistry-Paraffin-NBP2-30413-img0010.jpg "Immunohistochemistry-Paraffin: NDUFS2 Antibody [NBP2-30413] - Staining in human heart muscle and pancreas tissues using anti-NDUFS2 antibody. Corresponding NDUFS2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLD |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NDUFS2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-30413 | Applications | Species |
|---|---|---|
| Pang Y, Lu Y, et al. Targeting NAD+/PARP DNA Repair Pathway as a Novel Therapeutic Approach to SDHB-Mutated Cluster I Pheochromocytoma and Paraganglioma. Clin Cancer Res 2018-07-15 [PMID: 29636359] (WB, IF/IHC, Human) | WB, IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for NDUFS2 Antibody (NBP2-30413)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: NDUFS2 Antibody [NBP2-30413] - Analysis using Anti-NDUFS2 antibody NBP2-30413 (A) shows similar pattern to independent antibody NBP2-49351 (B).](http://images.novusbio.com/fullsize/NDUFS2-Antibody-Western-Blot-NBP2-30413-img0011.jpg "Western Blot: NDUFS2 Antibody [NBP2-30413] - Analysis using Anti-NDUFS2 antibody NBP2-30413 (A) shows similar pattern to independent antibody NBP2-49351 (B).")
![Immunocytochemistry/Immunofluorescence: NDUFS2 Antibody [NBP2-30413] - Staining of human cell line HeLa shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NDUFS2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30413-img0004.jpg "Immunocytochemistry/Immunofluorescence: NDUFS2 Antibody [NBP2-30413] - Staining of human cell line HeLa shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NDUFS2 Antibody [NBP2-30413] - Staining of human heart muscle shows high expression.](http://images.novusbio.com/fullsize/NDUFS2-Antibody-Immunohistochemistry-Paraffin-NBP2-30413-img0008.jpg "Immunohistochemistry-Paraffin: NDUFS2 Antibody [NBP2-30413] - Staining of human heart muscle shows high expression.")
![Immunohistochemistry-Paraffin: NDUFS2 Antibody [NBP2-30413] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/NDUFS2-Antibody-Immunohistochemistry-Paraffin-NBP2-30413-img0009.jpg "Immunohistochemistry-Paraffin: NDUFS2 Antibody [NBP2-30413] - Staining of human pancreas shows low expression as expected.")
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/Endothelin-1_QET00_ELISA_432.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/DATA_Endothelin1_QET00_ELISA_1074.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")