![Western Blot: NDUFB4 Antibody [NBP3-03538] - Analysis of extracts of various cell lines, using NDUFB4 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.](http://images.novusbio.com/fullsize/NDUFB4-Antibody-Western-Blot-NBP3-03538-img0004.jpg "Western Blot: NDUFB4 Antibody [NBP3-03538] - Analysis of extracts of various cell lines, using NDUFB4 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NDUFB4 (NP_001161803.1). MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIENPALLRWAYARTINVYPNFRPTPKNSLMG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NDUFB4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for NDUFB4 Antibody (NBP3-03538)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NDUFB4 |
![Immunocytochemistry/Immunofluorescence: NDUFB4 Antibody [NBP3-03538] - Analysis of U-2 OS cells using NDUFB4 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/NDUFB4-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03538-img0002.jpg "Immunocytochemistry/Immunofluorescence: NDUFB4 Antibody [NBP3-03538] - Analysis of U-2 OS cells using NDUFB4 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP3-03538] - Immunohistochemistry of paraffin-embedded rat kidney using [KO Validated] NDUFB4 Rabbit pAb (NBP3-03538) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/NDUFB4-Antibody-Immunohistochemistry-Paraffin-NBP3-03538-img0007.jpg "Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP3-03538] - Immunohistochemistry of paraffin-embedded rat kidney using [KO Validated] NDUFB4 Rabbit pAb (NBP3-03538) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/Immunofluorescence: NDUFB4 Antibody [NBP3-03538] - Analysis of L929 cells using NDUFB4 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/NDUFB4-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03538-img0001.jpg "Immunocytochemistry/Immunofluorescence: NDUFB4 Antibody [NBP3-03538] - Analysis of L929 cells using NDUFB4 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP3-03538] - Immunohistochemistry of paraffin-embedded human liver using [KO Validated] NDUFB4 Rabbit pAb (NBP3-03538) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/NDUFB4-Antibody-Immunohistochemistry-Paraffin-NBP3-03538-img0005.jpg "Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP3-03538] - Immunohistochemistry of paraffin-embedded human liver using [KO Validated] NDUFB4 Rabbit pAb (NBP3-03538) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP3-03538] - Immunohistochemistry of paraffin-embedded mouse kidney using [KO Validated] NDUFB4 Rabbit pAb (NBP3-03538) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/NDUFB4-Antibody-Immunohistochemistry-Paraffin-NBP3-03538-img0006.jpg "Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP3-03538] - Immunohistochemistry of paraffin-embedded mouse kidney using [KO Validated] NDUFB4 Rabbit pAb (NBP3-03538) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Knockout Validated: NDUFB4 Antibody [NBP3-03538] - Analysis of extracts from normal (control) and NDUFB4 knockout (KO) HeLa cells, using NDUFB4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/NDUFB4-Antibody-Knockout-Validated-NBP3-03538-img0003.jpg "Knockout Validated: NDUFB4 Antibody [NBP3-03538] - Analysis of extracts from normal (control) and NDUFB4 knockout (KO) HeLa cells, using NDUFB4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.")
![Neutralization TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Block_Neutralize_875.jpg)
![Western Blot TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Western_Blot_5303.jpg)
![Immunohistochemistry TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Immunohistochemistry_17355.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")