Home » NDUFA2 » NDUFA2 Proteins » NDUFA2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NDUFA2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NDUFA2 Protein (NBP1-88968PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NDUFA2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NDUFA2.

Source: E. coli

Amino Acid Sequence: RGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NDUFA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88968.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NDUFA2 Recombinant Protein Antigen

  • B8
  • CD14
  • CIB8
  • CI-B8
  • complex I B8 subunit
  • Complex I-B8
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 (8kD, B8)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
  • NADH-ubiquinone oxidoreductase B8 subunit
  • NADH-ubiquinone oxidoreductase subunit CI-B8

Background

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 (NDUFA2), also known as NADH-ubiquinone oxidoreductase B8 subunit, is an accessory subunit of the hydrophobic protein fraction of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). NDUFA2 may also play a role in regulating complex 1 activity and its assembly via assistance in redox processes. Mutations in the NDUFA2 gene are associated with Leigh syndrome, an early-onset progressive neurodegenerative disorder.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(659 Publications)
Species: Mu
Applications: ELISA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(140 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(300 Publications)
Species: Mu
Applications: ELISA
LBP [Biotin]
DY870-05
N/A LBP [Biotin]
(44 Publications)
Species: Hu
Applications: ELISA
TLR2 Antibody
(TL2.1) - BSA Free
NB100-56722
Flow (Cell Surface) TLR2 Antibody (TL2.1) - BSA Free
Flow Cytometry TLR2 Antibody (TL2.1) - BSA Free
Block/ Neutralize TLR2 Antibody (TL2.1) - BSA Free
(64 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
CD11b Antibody -
BSA Free
NB110-89474
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
(12 Reviews)
(114 Publications)
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CD34 Antibody
[Unconjugated]
AF4117
Immunohistochemistry CD34 Antibody [Unconjugated]
(3 Reviews)
(37 Publications)
Species: Rt
Applications: IHC, WB
Fc gamma RIII
(CD16) Antibody [Unco ...
AF1597
Western Blot Fc gamma RIII (CD16) Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: Block, WB
Doublecortin
Antibody
NBP1-72042
Western Blot Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(44 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Fc gamma
RIIIA/CD16a [Unconjug
4325-FC
SDS-PAGE Fc gamma RIIIA/CD16a [Unconjugated]
Binding Activity Fc gamma RIIIA/CD16a [Unconjugated]
SEC-MALS Fc gamma RIIIA/CD16a [Unconjugated]
(21 Publications)
Species: Hu
Applications: Bind
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(70 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
MD-2
1787-MD
MD-2
(19 Publications)
Species: Hu
Applications: Bind
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc

Publications for NDUFA2 Protein (NBP1-88968PEP) (0)

There are no publications for NDUFA2 Protein (NBP1-88968PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA2 Protein (NBP1-88968PEP) (0)

There are no reviews for NDUFA2 Protein (NBP1-88968PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NDUFA2 Protein (NBP1-88968PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDUFA2 Products

Research Areas for NDUFA2 Protein (NBP1-88968PEP)

Find related products by research area.

Blogs on NDUFA2

There are no specific blogs for NDUFA2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NDUFA2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NDUFA2