NAPE-PLD Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NAPEPLD |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for NAPE-PLD Antibody
Background
NAPE-PLD (also known as N-Acylphosphatidylethanolamine (NAPE)-hydrolyzing phospholipase D) is a membrane-bound phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine. NAPE-PLD has been shown to be expressed by specific populations of neurons in the brain and targeted to axonal processes. Recent studies have suggested that NAEs generated by NAPE-PLD in axons may act as anterograde synaptic signaling molecules that regulate the activity of postsynaptic neurons. NAPE-PLD has also been shown to catalyze the hydrolysis of NAPE to generate OEA (oleoylethanolamide), a natural lipid amide that inhibits food intake in free-feeding rodents by prolonging latency to feed and postmeal interval.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bt, Bv, Ca, Eq, Hu, Pm, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Pm, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
Species: Mu
Applications: IP, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Po
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC
Publications for NAPE-PLD Antibody (NBP1-88248) (0)
There are no publications for NAPE-PLD Antibody (NBP1-88248).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NAPE-PLD Antibody (NBP1-88248) (0)
There are no reviews for NAPE-PLD Antibody (NBP1-88248).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NAPE-PLD Antibody (NBP1-88248) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NAPE-PLD Products
Research Areas for NAPE-PLD Antibody (NBP1-88248)
Find related products by research area.
|
Blogs on NAPE-PLD