![Western Blot: Aminomethyltransferase Antibody [NBP1-89783] - Analysis in human cell line HepG2.](http://images.novusbio.com/fullsize/Aminomethyltransferase-Antibody-Western-Blot-NBP1-89783-img0005.jpg "Western Blot: Aminomethyltransferase Antibody [NBP1-89783] - Analysis in human cell line HepG2.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AMT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 44 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for Aminomethyltransferase Antibody (NBP1-89783)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Aminomethyltransferase Antibody [NBP1-89783] - Staining of human cell line HeLa shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Aminomethyltransferase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89783-img0007.jpg "Immunocytochemistry/Immunofluorescence: Aminomethyltransferase Antibody [NBP1-89783] - Staining of human cell line HeLa shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Aminomethyltransferase Antibody [NBP1-89783] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://images.novusbio.com/fullsize/Aminomethyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-89783-img0006.jpg "Immunohistochemistry-Paraffin: Aminomethyltransferase Antibody [NBP1-89783] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.")
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Western_Blot_20998.jpg)
![Immunohistochemistry Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Immunohistochemistry_17794.jpg)
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images/af952_human-cathepsin-l-affinity-purified-polyclonal-ab-8220249511428.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")