n-Myc Recombinant Protein Antigen

Name: n-Myc Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-56178PEP
Price: 279 USD

Images

There are currently no images for n-Myc Recombinant Protein Antigen (NBP2-56178PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

n-Myc Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human n-Myc. Source: E. coli Amino Acid Sequence: VEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	MYCN
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56178. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for n-Myc Recombinant Protein Antigen

BHLHE37
bHLHe37N-myc proto-oncogene protein
Class E basic helix-loop-helix protein 37
MODED
neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene
N-myc
NMYCneuroblastoma MYC oncogene
ODED
oncogene NMYC
pp65/67
v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived
v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)

Background

n-Myc is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-Myc Antibody
(9E10) - BSA Free

NB600-302

Western Blot c-Myc Antibody (9E10) - BSA Free

(4 Reviews)

(48 Publications)

Species: Bv, Dr, Hu, Mu

Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(43 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

NDRG1 Antibody

NBP1-86636

Immunohistochemistry-Paraffin NDRG1 Antibody

(5 Publications)

Species: Hu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

NM23-H1 Antibody

NBP1-80992

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

TrkA Antibody
[Unconjugated]

AF1056

Western Blot TrkA Antibody [Unconjugated]

(47 Publications)

Species: Rt

Applications: IHC, WB

HRAS Antibody

NBP2-42864

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

DAN/NBL1 Antibody
[Unconjugated]

AF755

(1 Publication)

Species: Mu

Applications: Block, WB

p21/CIP1/CDKN1A
Antibody (WA-1)

NBP2-29463

(24 Publications)

Species: Pm, Hu, Pm, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

p19ARF/CDKN2A
Antibody - BSA Free

NB200-106

Western Blot p19ARF/CDKN2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free

(1 Review)

(48 Publications)

Species: Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Enolase
2/Neuron-specific Eno ...

NB110-58870

Western Blot Enolase 2/Neuron-specific Enolase Antibody

Simple Western Enolase 2/Neuron-specific Enolase Antibody

(2 Reviews)

(5 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, KD, Simple Western, WB

Sonic Hedgehog/Shh
[Unconjugated]

464-SH

SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]

SEC-MALS Sonic Hedgehog/Shh [Unconjugated]

(70 Publications)

Species: Mu

Applications: BA

c-Fos Antibody
(2H2)

NBP2-50037

Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)

(1 Review)

(24 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, KO, WB

Bcl-2 Antibody

NB100-56098

(2 Reviews)

(28 Publications)

Species: Ca, Hu, Mu, Rt

Applications: IHC, IHC-P, IP, WB

RB1 Antibody
(607121) [Unconjugate

MAB6495

Immunocytochemistry RB1 Antibody (607121) [Unconjugated]

Simple Western RB1 Antibody (607121) [Unconjugated]

(5 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

NDRG2 Antibody
(6A5)

H00057447-M03

Immunohistochemistry NDRG2 Antibody (6A5)

(20 Publications)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB

EGFR Antibody
[Unconjugated]

AF231

Immunocytochemistry EGFR Antibody [Unconjugated]

Western Blot EGFR Antibody [Unconjugated]

(30 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB

NRAS Antibody
(6S6F3)

NBP3-16473

Species: Hu, Mu, Rt

Applications: ICC/IF, WB

SS18L1 Antibody

NBP2-20486

Immunohistochemistry-Paraffin SS18L1 Antibody

Immunocytochemistry/ Immunofluorescence SS18L1 Antibody

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, IP, WB

ErbB2/Her2
[Unconjugated]

1129-ER

(58 Publications)

Species: Hu

Applications: BA

n-Myc Recombinant
Protein Antigen

NBP2-56178PEP

Species: Hu

Applications: AC

Publications for n-Myc Recombinant Protein Antigen (NBP2-56178PEP) (0)

There are no publications for n-Myc Recombinant Protein Antigen (NBP2-56178PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for n-Myc Recombinant Protein Antigen (NBP2-56178PEP) (0)

There are no reviews for n-Myc Recombinant Protein Antigen (NBP2-56178PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for n-Myc Recombinant Protein Antigen (NBP2-56178PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional n-Myc Products

Research Areas for n-Myc Recombinant Protein Antigen (NBP2-56178PEP)

Find related products by research area.

Blogs on n-Myc.

Check out the latest blog posts on n-Myc.

Dual applications of a c-Myc antibody in mitochondrial research
c-Myc, a proto-oncogene, has documented involvement in cellular differentiation, cell growth, cell death and tumor formation. Target genes of the Myc family include those that participate in cell survival, translation, transcription, metabolism and... Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.

c-Myc Antibody (9E10) - BSA Free
NB600-302

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our n-Myc Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

MYCN

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

n-Myc Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

n-Myc Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for n-Myc Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for n-Myc Recombinant Protein Antigen (NBP2-56178PEP) (0)

Reviews for n-Myc Recombinant Protein Antigen (NBP2-56178PEP) (0)

FAQs for n-Myc Recombinant Protein Antigen (NBP2-56178PEP) (0)

Additional n-Myc Products

Research Areas for n-Myc Recombinant Protein Antigen (NBP2-56178PEP)

Blogs on n-Myc.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics