![Western Blot: MUC3B Antibody [NBP1-70644] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/MUC3B-Antibody-Western-Blot-NBP1-70644-img0003.jpg "Western Blot: MUC3B Antibody [NBP1-70644] - Jurkat cell lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to MUC3B(intestinal mucin MUC3B precursor) The peptide sequence was selected from the N terminal of MUC3B.
Peptide sequence MLCADVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFAD. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MUC3B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MUC3B |
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![N/A TFF3 [HRP]](https://images.novusbio.com/images2/TFF3_DTFF30_ELISA_460.jpg)
![N/A TFF3 [HRP]](https://images.novusbio.com/images2/DATA_TFF3_DTFF30_ELISA_840.jpg)
![CA125/MUC16 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "CA125/MUC16 [Unconjugated]")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")