Home » MTTP » MTTP Proteins » MTTP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MTTP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MTTP Recombinant Protein Antigen (NBP2-49154PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MTTP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTTP.

Source: E. coli

Amino Acid Sequence: SGSGILRRSNLNIFQYIGKAGLHGSQVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSASGDPISVVKGLI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MTTP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49154.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MTTP Recombinant Protein Antigen

  • 88kD)
  • 88kDa)
  • ABL
  • MGC149819
  • microsomal triglyceride transfer protein large subunit
  • microsomal triglyceride transfer protein
  • MTPMGC149820

Background

MTTP catalyzes the transport of triglyceride, cholesteryl ester, and phospholipid between phospholipid surfaces. MTTP is required for the secretion of plasma lipoproteins that contain apolipoprotein B. It is positively regulated by cholesterol and negatively regulated by insulin. Defects in MTP are the cause of abetalipoproteinemia (ABL).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BCR Antibody
AF5129
Western Blot BCR Antibody
(1 Publication)
Species: Hu
Applications: WB
c-Abl Antibody
[Unconjugated]
AF5414
Western Blot c-Abl Antibody [Unconjugated]
Simple Western c-Abl Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Apolipoprotein
B/ApoB Antibody (3697 ...
MAB4124
Immunohistochemistry Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]
Western Blot Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]
Simple Western Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]
(7 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(116 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(215 Publications)
Species: Hu
Applications: BA
Jak2 Antibody
(53B7) - BSA Free
NBP2-59451
Flow Cytometry Jak2 Antibody (53B7) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak2 Antibody (53B7) - BSA Free
Western Blot Jak2 Antibody (53B7) - BSA Free
(3 Reviews)
(3 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
ETV6/Tel Antibody
NBP1-80695
Western Blot ETV6/Tel Antibody
Immunohistochemistry-Paraffin ETV6/Tel Antibody
Immunohistochemistry-Paraffin ETV6/Tel Antibody
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CD34 Antibody
[Unconjugated]
AF4117
Immunohistochemistry CD34 Antibody [Unconjugated]
(3 Reviews)
(37 Publications)
Species: Rt
Applications: IHC, WB
CETP Antibody
(ATM192) - BSA Free
NB300-558
Immunocytochemistry/ Immunofluorescence CETP Antibody (ATM192) - BSA Free
Western Blot CETP Antibody (ATM192) - BSA Free
(1 Publication)
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for MTTP Recombinant Protein Antigen (NBP2-49154PEP) (0)

There are no publications for MTTP Recombinant Protein Antigen (NBP2-49154PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTTP Recombinant Protein Antigen (NBP2-49154PEP) (0)

There are no reviews for MTTP Recombinant Protein Antigen (NBP2-49154PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MTTP Recombinant Protein Antigen (NBP2-49154PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTTP Products

Research Areas for MTTP Recombinant Protein Antigen (NBP2-49154PEP)

Find related products by research area.

Blogs on MTTP

There are no specific blogs for MTTP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: MTTP Antibody [NBP1-62489] - Adult mouse small intestine homogenate, 20 ug total protein per lane. Antibody at 1:1000. Secondary HRP conjugated antibody at 1:5000. Bands visualized with Western Chemiluminescence HRP substrate, imaged with Syngene imaging system. WB image submitted by a verified customer review.
MTTP Antibody
NBP1-62489

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MTTP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MTTP