Home » MPP2 » MPP2 Proteins » MPP2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MPP2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MPP2 Recombinant Protein Antigen (NBP3-17060PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MPP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MPP2

Source: E. coli

Amino Acid Sequence: GLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MPP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17060.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MPP2 Recombinant Protein Antigen

  • Discs large homolog 2
  • DKFZp686A06252
  • DKFZp686J2189
  • DKFZp761D0712
  • DLG2discs large, homolog 2
  • MAGUK p55 subfamily member 2
  • membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2)
  • Protein MPP2

Background

MPP2 (Palmitoylated membrane protein 2) is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. MPP2/Palmitoylated membrane protein 2 contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in signal transduction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Guanylate kinase
Antibody (OTI4A8)
NBP2-00594
Flow Cytometry Guanylate kinase Antibody (OTI4A8)
Flow Cytometry Guanylate kinase Antibody (OTI4A8)
Flow Cytometry Guanylate kinase Antibody (OTI4A8)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
PSD-95 Antibody
(6G6-1C9) - BSA Free
NB300-556
Flow Cytometry PSD-95 Antibody (6G6-1C9) - BSA Free
Immunocytochemistry/ Immunofluorescence PSD-95 Antibody (6G6-1C9) - BSA Free
Immunocytochemistry/ Immunofluorescence PSD-95 Antibody (6G6-1C9) - BSA Free
(1 Review)
(31 Publications)
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DLG1 Antibody
NB600-1229
Immunocytochemistry/ Immunofluorescence DLG1 Antibody
Immunocytochemistry/ Immunofluorescence DLG1 Antibody
Western Blot DLG1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
FoxM1 Antibody
AF3975
Western Blot FoxM1 Antibody
Immunocytochemistry FoxM1 Antibody
Western Blot FoxM1 Antibody
(2 Publications)
Species: Hu
Applications: ICC, WB
PSD-95 Antibody
(6G6-1C9) - BSA Free
NB300-556
Flow Cytometry PSD-95 Antibody (6G6-1C9) - BSA Free
Immunocytochemistry/ Immunofluorescence PSD-95 Antibody (6G6-1C9) - BSA Free
Immunocytochemistry/ Immunofluorescence PSD-95 Antibody (6G6-1C9) - BSA Free
(1 Review)
(31 Publications)
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
SAP102 Antibody
NBP1-87691
Western Blot SAP102 Antibody
Immunohistochemistry-Paraffin SAP102 Antibody
Immunohistochemistry-Paraffin SAP102 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
MPP3 Antibody
NBP1-85014
Immunocytochemistry/ Immunofluorescence MPP3 Antibody
Western Blot MPP3 Antibody
Immunohistochemistry-Paraffin MPP3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PISD Antibody
(OTI4G5)
NBP2-46421
Immunohistochemistry PISD Antibody (OTI4G5)
Immunohistochemistry PISD Antibody (OTI4G5)
Western Blot PISD Antibody (OTI4G5)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PSD Antibody
H00005662-B01P
Western Blot PSD Antibody
Immunocytochemistry/ Immunofluorescence PSD Antibody
Western Blot PSD Antibody
Species: Hu, Rt
Applications: ICC/IF, WB
Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunohistochemistry-Paraffin Tight Junction Protein 1 Antibody
(5 Reviews)
(20 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
MPP1 Antibody
(1E11-1G11)
H00004354-M01
Western Blot MPP1 Antibody (1E11-1G11)
Immunocytochemistry/ Immunofluorescence MPP1 Antibody (1E11-1G11)
Immunoprecipitation MPP1 Antibody (1E11-1G11)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
MAP1A Antibody
NBP2-32630
Immunohistochemistry-Paraffin MAP1A Antibody
Immunohistochemistry-Paraffin MAP1A Antibody
Immunohistochemistry-Paraffin MAP1A Antibody
Species: Hu
Applications: IHC, IHC-P
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Lgl1 Antibody (5G2)
H00003996-M01
Western Blot Lgl1 Antibody (5G2)
ELISA Lgl1 Antibody (5G2)
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NDOR1 Antibody
NBP1-88790
Immunocytochemistry/ Immunofluorescence NDOR1 Antibody
Immunohistochemistry-Paraffin NDOR1 Antibody
Immunohistochemistry-Paraffin NDOR1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NMDAR1 Antibody
(R1JHL) - Azide and B ...
NB300-118
Western Blot NMDAR1 Antibody (R1JHL) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence NMDAR1 Antibody (R1JHL) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence NMDAR1 Antibody (R1JHL) - Azide and BSA Free
(14 Reviews)
(21 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for MPP2 Recombinant Protein Antigen (NBP3-17060PEP) (0)

There are no publications for MPP2 Recombinant Protein Antigen (NBP3-17060PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPP2 Recombinant Protein Antigen (NBP3-17060PEP) (0)

There are no reviews for MPP2 Recombinant Protein Antigen (NBP3-17060PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MPP2 Recombinant Protein Antigen (NBP3-17060PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MPP2 Products

Blogs on MPP2

There are no specific blogs for MPP2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
PSD-95 Antibody (6G6-1C9) - BSA Free
NB300-556
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. ICC/IF image submitted by a verified customer review.
Tight Junction Protein 1 Antibody
NBP1-85047

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MPP2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MPP2