![Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Rat liver using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35587_rabbit-monoamine-oxidase-b-pab-1012202411531015.jpg "Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Rat liver using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 400-490 of human Monoamine Oxidase B (MAOB) (NP_000889.3). Sequence: TYFPPGILTQYGRVLRQPVDRIYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAOB |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 59 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Monoamine Oxidase B Antibody (NBP3-35587)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAOB |
![Immunocytochemistry/ Immunofluorescence: Monoamine Oxidase B Antibody [NBP3-35587] - Immunofluorescence analysis of U2OS cells using Monoamine Oxidase B(Monoamine Oxidase B(MAOB)) Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-35587_rabbit-monoamine-oxidase-b-pab-1012202411552848.jpg "Immunocytochemistry/ Immunofluorescence: Monoamine Oxidase B Antibody [NBP3-35587] - Immunofluorescence analysis of U2OS cells using Monoamine Oxidase B(Monoamine Oxidase B(MAOB)) Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35587_rabbit-monoamine-oxidase-b-pab-101220241224180.jpg "Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Human liver using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35587_rabbit-monoamine-oxidase-b-pab-101220241243972.jpg "Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Human liver using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: Monoamine Oxidase B Antibody [NBP3-35587] - Immunofluorescence analysis of L929 cells using Monoamine Oxidase B(Monoamine Oxidase B(MAOB)) Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-35587_rabbit-monoamine-oxidase-b-pab-1012202411545521.jpg "Immunocytochemistry/ Immunofluorescence: Monoamine Oxidase B Antibody [NBP3-35587] - Immunofluorescence analysis of L929 cells using Monoamine Oxidase B(Monoamine Oxidase B(MAOB)) Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Monoamine Oxidase B Antibody [NBP3-35587] - Immunofluorescence analysis of NIH/3T3 cells using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-35587_rabbit-monoamine-oxidase-b-pab-101220241233890.jpg "Immunocytochemistry/ Immunofluorescence: Monoamine Oxidase B Antibody [NBP3-35587] - Immunofluorescence analysis of NIH/3T3 cells using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot: Monoamine Oxidase B Antibody [NBP3-35587] - Western blot analysis of lysates from HeLa cells, using Monoamine Oxidase B(MAOB) Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.](http://images.novusbio.com/fullsize/nbp3-35587_rabbit-monoamine-oxidase-b-pab-10122024120657.jpg "Western Blot: Monoamine Oxidase B Antibody [NBP3-35587] - Western blot analysis of lysates from HeLa cells, using Monoamine Oxidase B(MAOB) Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.")
![Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Rat heart using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35587_rabbit-monoamine-oxidase-b-pab-101220241224161.jpg "Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Rat heart using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Human colon using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35587_rabbit-monoamine-oxidase-b-pab-10122024120690.jpg "Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Human colon using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")