![Western Blot: Monoamine Oxidase B Antibody [NBP1-59569] - Mice were pretreated with 5ECdsAP1 aptamer before amphetamine application; tissue samples collected (n = 4 per group) from the VTA at 90 (60 + 30 min) and 180 (60 + 30 + 90 min) minutes after amphetamine. Protein was obtained for Western blot quantitation of MAO-A level using Actin (lower molecular fragments) as a reference shown in lanes 2-4 (90 min samples) or lane 5-6 (180 min). Total protein (10 ug) was used for all lanes except lanes 7 & 9. The blot was stripped and used for MAO-B. Lane 1: molecular size marker of 10 KD ladder; lane 2: 5ECdsAP1 (4 nmol/kg, icv, 1/2 dose); lanes 3 & 5: saline (2 ul, icv); lanes 4 & 6: 5ECdsAP1 (8 nmol/kg, icv); lanes 7, 8, 9 are controls of naive mice with no aptamer or amphetamine (5, 10 and 20 ug protein). Image collected and cropped by CiteAb from the following publication (//www.jbiomedsci.com/content/23/1/21), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Monoamine-Oxidase-B-Antibody-Western-Blot-NBP1-59569-img0007.jpg "Western Blot: Monoamine Oxidase B Antibody [NBP1-59569] - Mice were pretreated with 5ECdsAP1 aptamer before amphetamine application; tissue samples collected (n = 4 per group) from the VTA at 90 (60 + 30 min) and 180 (60 + 30 + 90 min) minutes after amphetamine. Protein was obtained for Western blot quantitation of MAO-A level using Actin (lower molecular fragments) as a reference shown in lanes 2-4 (90 min samples) or lane 5-6 (180 min). Total protein (10 ug) was used for all lanes except lanes 7 & 9. The blot was stripped and used for MAO-B. Lane 1: molecular size marker of 10 KD ladder; lane 2: 5ECdsAP1 (4 nmol/kg, icv, 1/2 dose); lanes 3 & 5: saline (2 ul, icv); lanes 4 & 6: 5ECdsAP1 (8 nmol/kg, icv); lanes 7, 8, 9 are controls of naive mice with no aptamer or amphetamine (5, 10 and 20 ug protein). Image collected and cropped by CiteAb from the following publication (//www.jbiomedsci.com/content/23/1/21), licensed under a CC-BY license.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to MAOB(monoamine oxidase B) The peptide sequence was selected from the N terminal of MAOB. Peptide sequence RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV. The peptide sequence for this immunogen was taken from within the described region. |
| Marker | Mitochondrial Outer Membrane Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAOB |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Monoamine Oxidase B Antibody validated for Simple Western from a verified customer review. |
|
| Theoretical MW | 59 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Publication using NBP1-59569 | Applications | Species |
|---|---|---|
| Liu CH, Ren J, Liu PK. Amphetamine manipulates monoamine oxidase-A level and behavior using theranostic aptamers of transcription factors AP-1/NF-kB J. Biomed. Sci. 2016-02-04 [PMID: 26841904] (WB, Mouse) | WB | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Stella Dracheva |
Simple Western | Human | 04/06/2023 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Monoamine Oxidase B Antibody (NBP1-59569)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Stella Dracheva 04/06/2023 |
||
| Application: | Simple Western | |
| Species: | Human |
![Immunohistochemistry-Paraffin: Monoamine Oxidase B Antibody [NBP1-59569] - Human Liver tissue.](http://images.novusbio.com/fullsize/Monoamine-Oxidase-B-Antibody-Immunohistochemistry-Paraffin-NBP1-59569-img0005.jpg "Immunohistochemistry-Paraffin: Monoamine Oxidase B Antibody [NBP1-59569] - Human Liver tissue.")
![Western Blot: Monoamine Oxidase B Antibody [NBP1-59569] - Human heart.](http://images.novusbio.com/fullsize/Monoamine-Oxidase-B-Antibody-Western-Blot-NBP1-59569-img0006.jpg "Western Blot: Monoamine Oxidase B Antibody [NBP1-59569] - Human heart.")
![Simple Western: Monoamine Oxidase B Antibody [NBP1-59569] - Monoamine Oxidase B Antibodies (NBP1-59569), ProteinSimple Western Blot on Jess Instrument. One microgram of human brain tissue lysate was tested with the antibodies diluted 1:10 or 1:20 times. Image from verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp1-59569_rabbit-polyclonal-monoamine-oxidase-b-antibody-simple-western-2042023113029.jpg "Simple Western: Monoamine Oxidase B Antibody [NBP1-59569] - Monoamine Oxidase B Antibodies (NBP1-59569), ProteinSimple Western Blot on Jess Instrument. One microgram of human brain tissue lysate was tested with the antibodies diluted 1:10 or 1:20 times. Image from verified customer review.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
