![Western Blot: MOGAT2 Antibody [NBP1-85230] - Analysis in control (vector only transfected HEK293T lysate) and MOGAT2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/MOGAT2-Antibody-Western-Blot-NBP1-85230-img0008.jpg "Western Blot: MOGAT2 Antibody [NBP1-85230] - Analysis in control (vector only transfected HEK293T lysate) and MOGAT2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VPIFSFGENDLFDQIPNSSGSWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEEVNQLHQRYIKELCNLFEAHKLKFNIPADQHLEF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MOGAT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot SOX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX2_AF2018_Western_Blot_5161.jpg)
![Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX2_AF2018_Chromatin_Immunoprecipitation_11224.jpg)
![Simple Western SOX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX2_AF2018_Simple_Western_16676.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MOGAT2 |
![Immunohistochemistry-Paraffin: MOGAT2 Antibody [NBP1-85230] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/MOGAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-85230-img0007.jpg "Immunohistochemistry-Paraffin: MOGAT2 Antibody [NBP1-85230] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: MOGAT2 Antibody [NBP1-85230] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/MOGAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-85230-img0005.jpg "Immunohistochemistry-Paraffin: MOGAT2 Antibody [NBP1-85230] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: MOGAT2 Antibody [NBP1-85230] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/MOGAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-85230-img0006.jpg "Immunohistochemistry-Paraffin: MOGAT2 Antibody [NBP1-85230] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Immunohistochemistry_11019.jpg)
![Western Blot Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Western_Blot_11065.jpg)
![Knockout Validated Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Knockout_Validated_23118.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot SOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX1_AF3369_Western_Blot_21133.jpg)
![Simple Western SOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX1_AF3369_Simple_Western_21134.jpg)
![Immunocytochemistry SOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX1_AF3369_Immunocytochemistry_12364.jpg)
![Immunocytochemistry SOX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX3_AF2569_Immunocytochemistry_9767.jpg)
![Immunocytochemistry SOX3 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2569_human-sox3-affinity-purified-polyclonal-ab-immunocytochemistry-2010202310230.jpg)
![Western Blot SOX3 Antibody [Unconjugated]](https://images.novusbio.com/images/af2569_human-sox3-affinity-purified-polyclonal-ab-8120255534744.jpg)
![Immunohistochemistry GIP Antibody (911205) [Unconjugated]](https://images.novusbio.com/images2/GIP_MAB8864_Immunohistochemistry_17088.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")