Novus Biologicals products are now on bio-techne.com

MAGEA4 Recombinant Protein Antigen

Name: MAGEA4 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84365PEP
Price: 279 USD

Images

There are currently no images for MAGEA4 Protein (NBP1-84365PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MAGEA4 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAGEA4. Source: E. coli Amino Acid Sequence: WRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	MAGEA4
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84365. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAGEA4 Recombinant Protein Antigen

CT1.4
MAGE-41
MAGE4A
MAGE4B
MAGEA4
MAGE-X2 antigen
MAGE-X2
melanoma antigen family A, 4
melanoma-associated antigen 4
member 4

Background

MAGEA4 is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. At least four variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAGEA3 Antibody
(21B4) - Chimeric - A ...

NBP3-20167

Immunocytochemistry/ Immunofluorescence MAGEA3 Antibody (21B4) - Chimeric - Azide and BSA Free

Flow Cytometry MAGEA3 Antibody (21B4) - Chimeric - Azide and BSA Free

Species: Hu

Applications: ELISA, Flow, ICC/IF, IHC, IP, WB

CTAG1B Antibody
(OTI2B6)

NBP1-47714

Species: Hu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

MAGEA1 Antibody

NBP3-38158

Immunocytochemistry/ Immunofluorescence MAGEA1 Antibody

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

MAGEA6 Antibody -
BSA Free

NBP3-05152

Immunocytochemistry/ Immunofluorescence MAGEA6 Antibody - BSA Free

Species: Hu, Mu

Applications: ICC/IF, WB

MAGEB2 Antibody

NBP2-62688

Species: Hu

Applications: IHC, IHC-P

MAGEC1 Antibody

NBP1-85397

Species: Hu

Applications: IHC, IHC-P, WB

CTAG2 Antibody

NBP2-49659

Species: Hu

Applications: IHC, IHC-P

Oct-3/4 Antibody
[Unconjugated]

AF1759

Immunocytochemistry Oct-3/4 Antibody [Unconjugated]

Simple Western Oct-3/4 Antibody [Unconjugated]

(77 Publications)

Species: Hu, Mu

Applications: ChIP, ICC, IP, Simple Western, WB

HLA ABC Antibody
(W6/32)

NB100-64775

Immunohistochemistry-Frozen HLA ABC Antibody (W6/32)

(2 Reviews)

(31 Publications)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, Func, IHC, IHC-Fr, IHC-P (-), IP

SCP1 Antibody -
BSA Free

NB300-229

(3 Reviews)

(57 Publications)

Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt

Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

Melanoma antigen
family C2 Antibody

NBP2-34145

Species: Hu

Applications: ICC/IF, IHC, IHC-P

CD117/c-kit
Antibody [Unconjugate

AF1356

Western Blot CD117/c-kit Antibody [Unconjugated]

Immunohistochemistry CD117/c-kit Antibody [Unconjugated]

(4 Reviews)

(116 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB

Melan-A/MART-1
Antibody (A19-P)

NBP1-30151

(4 Reviews)

(22 Publications)

Species: Ca, Hu, Mu

Applications: ICC/IF, IHC, IHC-P

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(42 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

MAGEA12 Antibody
(3A10)

H00004111-M01

Species: Hu, Mu

Applications: ELISA, WB

GAGE1 Antibody

NBP2-54704

Species: Hu

Applications: IHC, IHC-P

CD8 Antibody
(53-6.7) - BSA Free

NBP1-49045

Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free

Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free

(3 Reviews)

(28 Publications)

Species: Mu, Rt

Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc

MAGEA4 Recombinant
Protein Antigen

NBP1-84365PEP

Species: Hu

Applications: AC

Publications for MAGEA4 Protein (NBP1-84365PEP) (0)

There are no publications for MAGEA4 Protein (NBP1-84365PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEA4 Protein (NBP1-84365PEP) (0)

There are no reviews for MAGEA4 Protein (NBP1-84365PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAGEA4 Protein (NBP1-84365PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAGEA4 Products

Research Areas for MAGEA4 Protein (NBP1-84365PEP)

Find related products by research area.

Cancer

Blogs on MAGEA4

There are no specific blogs for MAGEA4, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line and MC/9-2 mouse mast cell line, loaded at 0.2 mg/mL. A specific band was detected for CD117/c-kit at approximately 150-165 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.

CD117/c-kit Antibody [Unconjugated]
AF1356

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our MAGEA4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

MAGEA4

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

MAGEA4 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

MAGEA4 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for MAGEA4 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for MAGEA4 Protein (NBP1-84365PEP) (0)

Reviews for MAGEA4 Protein (NBP1-84365PEP) (0)

FAQs for MAGEA4 Protein (NBP1-84365PEP) (0)

Additional MAGEA4 Products

Research Areas for MAGEA4 Protein (NBP1-84365PEP)

Blogs on MAGEA4

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics