![Western Blot: MAGEC1 Antibody [NBP1-85397] - Analysis in human cell line U-2 OS and human cell line CACO-2.](http://images.novusbio.com/fullsize/MAGEC1-Antibody-Western-Blot-NBP1-85397-img0011.jpg "Western Blot: MAGEC1 Antibody [NBP1-85397] - Analysis in human cell line U-2 OS and human cell line CACO-2.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSALLSIFQSSPESTQSPFEGFPQSVLQIPVSAASSSTLVSIFQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAGEC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAGEC1 |
![Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining in human testis and pancreas tissues.. Corresponding MAGEC1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MAGEC1-Antibody-Immunohistochemistry-Paraffin-NBP1-85397-img0010.jpg "Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining in human testis and pancreas tissues.. Corresponding MAGEC1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining of human epididymis shows low expression as expected.](http://images.novusbio.com/fullsize/MAGEC1-Antibody-Immunohistochemistry-Paraffin-NBP1-85397-img0005.jpg "Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining of human epididymis shows low expression as expected.")
![Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining in human testis and epididymis tissues using anti-MAGEC1 antibody. Corresponding MAGEC1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MAGEC1-Antibody-Immunohistochemistry-Paraffin-NBP1-85397-img0007.jpg "Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining in human testis and epididymis tissues using anti-MAGEC1 antibody. Corresponding MAGEC1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining of human testis shows strong cytoplasmic positivity in spermatogonia.](http://images.novusbio.com/fullsize/MAGEC1-Antibody-Immunohistochemistry-Paraffin-NBP1-85397-img0008.jpg "Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining of human testis shows strong cytoplasmic positivity in spermatogonia.")
![Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/MAGEC1-Antibody-Immunohistochemistry-Paraffin-NBP1-85397-img0009.jpg "Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells.")
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")