Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 (NP_001017426.1). LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
KDM6B |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Western Blot 1:500-1:2000
|
Theoretical MW |
176 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.05% Proclin 300 |
Purity |
Affinity purified |
Alternate Names for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free
Background
JMJD3 is a histone demethylase that specifically demethylates trimethylated and dimethylated 'Lys-27' of histone H3, thereby playing a central role in histone code. JMJD3 is also important for the regulation of posterior development by regulating HOX gene expression. JMJD3 is involved in inflammatory response by participating in macrophage differentiation in case of inflammation by regulating gene expression and macrophage differentiation. It has also been shown to be essential to mammalian epidermal differentiation and is upregulated in prostate cancer.
JMJD3 antibodies are useful tools for epigenetics research and specifically for histone modification studies.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IP, WB
Species: Hu
Applications: ChIP, ICC, ICFlow, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92982) (0)
There are no publications for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92982).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92982) (0)
There are no reviews for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92982).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92982) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Products
Research Areas for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92982)
Find related products by research area.
|
Blogs on Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3