![Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of extracts of mouse brain, using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST](http://images.novusbio.com/fullsize/Lysine-K-specific-Demethylase-6B-KDM6B-JMJD3-Antibody-Western-Blot-NBP2-92982-img0003.jpg "Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of extracts of mouse brain, using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 (NP_001017426.1). LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KDM6B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 176 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92982)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KDM6B |
![Immunocytochemistry/Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of U2OS cells using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Lysine-K-specific-Demethylase-6B-KDM6B-JMJD3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92982-img0002.jpg "Immunocytochemistry/Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of U2OS cells using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of extracts of various cell lines, using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 .Exposure time: 90s.](http://images.novusbio.com/fullsize/Lysine-K-specific-Demethylase-6B-KDM6B-JMJD3-Antibody-Western-Blot-NBP2-92982-img0004.jpg "Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of extracts of various cell lines, using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 .Exposure time: 90s.")
![Immunocytochemistry/Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of NIH/3T3 cells using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Lysine-K-specific-Demethylase-6B-KDM6B-JMJD3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92982-img0001.jpg "Immunocytochemistry/Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of NIH/3T3 cells using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images2/EZH2_AF4767_Western_Blot_12571.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240516.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240219.jpg)
![Western Blot T-bet/TBX21 Antibody (525803) [Unconjugated]](https://images.novusbio.com/images2/T-bet_MAB5385_Western_Blot_6233.jpg)
![Intracellular Staining by Flow Cytometry T-bet/TBX21 Antibody (525803) [Unconjugated]](https://images.novusbio.com/images2/T-bet_MAB5385_Flow_Cytometry_8529.jpg)
![Intracellular Staining by Flow Cytometry T-bet/TBX21 Antibody (525803) [Unconjugated]](https://images.novusbio.com/images/antibody/mab5385_human-t-bet-mab-clone-525803-intracellular-staining-by-flow-cytometry-2932024154136.jpg)
![Immunoprecipitation SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Immunoprecipitation_15440.jpg)
![Western Blot SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Western_Blot_12094.jpg)
![Immunocytochemistry SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Immunocytochemistry__Immunofluorescence_20494.jpg)
![Western Blot Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Western_Blot_5320.jpg)
![Intracellular Staining by Flow Cytometry Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Flow_Cytometry_20834.jpg)
![Chromatin Immunoprecipitation (ChIP) Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Chromatin_Immunoprecipitation_11236.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")