Home » Lymphotoxin beta R/TNFRSF3 » Lymphotoxin beta R/TNFRSF3 Proteins » Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lymphotoxin beta R/TNFRSF3.

Source: E. coli

Amino Acid Sequence: EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LTBR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68777.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen

  • CD18
  • D12S370
  • ltbetar
  • LT-BETA-R
  • LTBR
  • lymphotoxin B receptor
  • Lymphotoxin beta R
  • lymphotoxin beta receptor (TNFR superfamily, member 3)
  • Lymphotoxin-beta receptor
  • LymphotoxinbR
  • TNF RIII
  • TNF Rrp
  • TNFCRTNF-RIII
  • TNFR superfamily, member 3
  • TNFR2-RP
  • TNFR3
  • TNF-R-III
  • TNFR-RP
  • TNFRSF3
  • TNFRSF3TNFR-III
  • Tumor necrosis factor C receptor
  • Tumor necrosis factor receptor 2-related protein
  • tumor necrosis factor receptor superfamily member 3
  • tumor necrosis factor receptor superfamily, member 3
  • Tumor necrosis factor receptor type III

Background

LT-beta-R, also known as lymphotoxin beta receptor and tumor necrosis factor receptor superfamily member 3 is a 47 kD transmembrane protein containing 3 TNF receptor domains. The LT-beta-R is a receptor for the heterotrimeric lymphotoxin complex (composed of LT alpha and LT beta as well as LIGHT. LT-beta-R is highly expressed in the lung, liver, and kidney and moderately expressed expressed in the heart and testes. LT-beta-R is weakly expressed in the brain, thymus, spleen, and lymph nodes. The cytoplasmic tail of LT-beta-R interacts with TRAF3, TRAF4, and TRAF5 as well as the hepatitis C virus core protein. Ligand binding to LT-beta-R has been shown to induce apoptosis (via TRAF3 and TRAF5) and play a role in the development of lymphoid organs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD11b Antibody -
BSA Free
NB110-89474
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
(12 Reviews)
(114 Publications)
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Integrin alpha
L/CD11a Antibody (345 ...
MAB3595
Western Blot Integrin alpha L/CD11a Antibody (345913) [Unconjugated]
Simple Western Integrin alpha L/CD11a Antibody (345913) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
ICAM-1/CD54
Antibody [Unconjugate
AF796
Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
(6 Reviews)
(88 Publications)
Species: Mu
Applications: AdBlk, IHC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Integrin beta
2/CD18 Antibody [Unco ...
AF1730
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
L-Selectin/CD62L
Antibody (4G8) [Uncon ...
BBA24
Flow Cytometry L-Selectin/CD62L Antibody (4G8) [Unconjugated]
(9 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
CD11c Antibody
(AP-MAB0806) - Azide ...
NB110-97871
Immunohistochemistry-Paraffin CD11c Antibody (AP-MAB0806) - Azide and BSA Free
Immunohistochemistry-Paraffin CD11c Antibody (AP-MAB0806) - Azide and BSA Free
(15 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(664 Publications)
Species: Mu
Applications: ELISA
CD14 [HRP]
DC140
N/A CD14 [HRP]
N/A CD14 [HRP]
(141 Publications)
Species: Hu
Applications: ELISA
NDUFA2 Antibody -
BSA Free
NBP2-93743
Immunocytochemistry/ Immunofluorescence NDUFA2 Antibody - BSA Free
Western Blot NDUFA2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Integrin beta
1/CD29 Antibody (P5D2 ...
MAB17781
Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
Immunocytochemistry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
(35 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]
Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]
Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]
(1 Review)
(183 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
E-Selectin/CD62E
Antibody (BBIG-E4) [U ...
BBA16
Immunohistochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
Immunocytochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
Flow Cytometry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
(1 Review)
(60 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB

Myeloperoxidase/MPO An ...
AF3667
Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]
Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]
Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]
(3 Reviews)
(167 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB

Publications for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP) (0)

There are no publications for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP) (0)

There are no reviews for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lymphotoxin beta R/TNFRSF3 Products

Research Areas for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP)

Find related products by research area.

Blogs on Lymphotoxin beta R/TNFRSF3

There are no specific blogs for Lymphotoxin beta R/TNFRSF3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LTBR