![Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.](http://images.novusbio.com/fullsize/LIV-1-Zip6-Antibody-Western-Blot-NBP1-59357-img0003.jpg "Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to SLC39A6(solute carrier family 39 (zinc transporter), member 6) The peptide sequence was selected from the middle region of SLC39A6.
Peptide sequence RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC39A6 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
![Western Blot HIPK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HIPK1_AF5617_Western_Blot_5780.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LIV-1/Zip6 Antibody (NBP1-59357)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: LIV-1/Zip6 Antibody [NBP1-59357] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://images.novusbio.com/fullsize/LIV-1-Zip6-Antibody-Immunohistochemistry-Paraffin-NBP1-59357-img0002.jpg "Immunohistochemistry-Paraffin: LIV-1/Zip6 Antibody [NBP1-59357] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.")
![Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: MCF7.](http://images.novusbio.com/fullsize/LIV-1-Zip6-Antibody-Western-Blot-NBP1-59357-img0008.jpg "Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: MCF7.")
![Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: 721_B.](http://images.novusbio.com/fullsize/LIV-1-Zip6-Antibody-Western-Blot-NBP1-59357-img0007.jpg "Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: 721_B.")
![Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: 293T.](http://images.novusbio.com/fullsize/LIV-1-Zip6-Antibody-Western-Blot-NBP1-59357-img0006.jpg "Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: 293T.")
![Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: Human Fetal Brain.](http://images.novusbio.com/fullsize/LIV-1-Zip6-Antibody-Western-Blot-NBP1-59357-img0009.jpg "Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: Human Fetal Brain.")
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Simple_Western_21000.jpg)
![Western Blot STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Western_Blot_5993.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Knockout_Validated_21531.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")