![Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human salivary gland shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC39A8-ZIP8-Antibody-Immunohistochemistry-Paraffin-NBP2-34058-img0007.jpg "Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human salivary gland shows strong membranous positivity in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC39A8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC39A8/ZIP8 Antibody (NBP2-34058)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human placenta shows distinct membranous positivity in syncytiotrophoblasts.](http://images.novusbio.com/fullsize/SLC39A8-ZIP8-Antibody-Immunohistochemistry-Paraffin-NBP2-34058-img0001.jpg "Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human placenta shows distinct membranous positivity in syncytiotrophoblasts.")
![Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human pancreas shows negative membranous positivity in islets of Langerhans and moderate membranous positivity in exocrien pancreas.](http://images.novusbio.com/fullsize/SLC39A8-ZIP8-Antibody-Immunohistochemistry-Paraffin-NBP2-34058-img0002.jpg "Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human pancreas shows negative membranous positivity in islets of Langerhans and moderate membranous positivity in exocrien pancreas.")
![Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human lung shows moderate membranous positivity in pneumocytes.](http://images.novusbio.com/fullsize/SLC39A8-ZIP8-Antibody-Immunohistochemistry-Paraffin-NBP2-34058-img0003.jpg "Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human lung shows moderate membranous positivity in pneumocytes.")
![Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human kidney shows moderate membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/SLC39A8-ZIP8-Antibody-Immunohistochemistry-Paraffin-NBP2-34058-img0004.jpg "Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human kidney shows moderate membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/SLC39A8-ZIP8-Antibody-Immunohistochemistry-Paraffin-NBP2-34058-img0005.jpg "Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human rectum shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC39A8-ZIP8-Antibody-Immunohistochemistry-Paraffin-NBP2-34058-img0006.jpg "Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human rectum shows moderate membranous positivity in glandular cells.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot CHMP2B Antibody (791521) [Unconjugated]](https://images.novusbio.com/images2/CHMP2B_MAB7509_Western_Blot_12719.jpg)
![Immunohistochemistry CHMP2B Antibody (791521) [Unconjugated]](https://images.novusbio.com/images2/CHMP2B_MAB7509_Immunohistochemistry_13107.jpg)
![Knockout Validated CHMP2B Antibody (791521) [Unconjugated]](https://images.novusbio.com/images2/mab7509_human-chmp2b-mab-clone-791521-knockout-validated-89202211244.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")