Lactoperoxidase Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human Lactoperoxidase. Peptide sequence: ENPGVFTNEQKDSLQKMSFSRLVCDNTRITKVPRDPFWANSYPYDFVDCS The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
LPO |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Lactoperoxidase Antibody
Background
Lactoperoxidase is an antibacterial agent in cow milk. The heme protein lactoperoxidase (LPO), also referred to as salivary peroxidase (SPO), is an oxidoreductase secreted into milk. LPO belongs to the XPO subfamily of the peroxidase family. It is expressed in mammary and salivary glands, and in the presence of H2O2, LPO acts as a catalyst for the oxidation of many phenols and aromatic amines. It is crucial for protecting the lactating mammary gland and intestinal tract of newborn infants against microorganisms. LPO binds one calcium ion per heterodimer and one heme B (iron-protoporphyrin IX) group covalently per heterodimer. The LPO gene, which spans 28 kb, is similar in gene organization and sequence to the peroxidase genes MPO and EPX, suggesting the possibility that these genes evolved from a common ancestral gene. The LPO and MPO genes are arranged in a tail-to-tail manner on chromosome 17q23.1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for Lactoperoxidase Antibody (NBP2-87716) (0)
There are no publications for Lactoperoxidase Antibody (NBP2-87716).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lactoperoxidase Antibody (NBP2-87716) (0)
There are no reviews for Lactoperoxidase Antibody (NBP2-87716).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Lactoperoxidase Antibody (NBP2-87716) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Lactoperoxidase Products
Research Areas for Lactoperoxidase Antibody (NBP2-87716)
Find related products by research area.
|
Blogs on Lactoperoxidase