Home » INPP1 » INPP1 Proteins » INPP1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

INPP1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for INPP1 Protein (NBP1-85889PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

INPP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human INPP1.

Source: E. coli

Amino Acid Sequence: RELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFPGLEKNIFGEESNEFTN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
INPP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85889.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for INPP1 Recombinant Protein Antigen

  • EC 3.1.3.57
  • inositol polyphosphate 1-phosphatase
  • inositol polyphosphate-1-phosphatase
  • IPP
  • IPPase
  • MGC110984

Background

INPP1 encodes the enzyme inositol polyphosphate-1-phosphatase, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FDPS Antibody
NBP2-16463
Western Blot FDPS Antibody
Western Blot FDPS Antibody
Immunocytochemistry/ Immunofluorescence FDPS Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
GGPS1 Antibody
NBP1-83368
Immunohistochemistry-Paraffin GGPS1 Antibody
Immunohistochemistry-Paraffin GGPS1 Antibody
Immunohistochemistry-Paraffin GGPS1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MSX2 Antibody
NBP1-85445
Immunohistochemistry-Paraffin MSX2 Antibody
Immunohistochemistry-Paraffin MSX2 Antibody
Immunohistochemistry-Paraffin MSX2 Antibody
(4 Publications)
Species: Hu
Applications: IHC, IHC-P
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/ Immunofluorescence Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
ILK Antibody (4F10)
H00003611-M01
Western Blot ILK Antibody (4F10)
Immunocytochemistry/ Immunofluorescence ILK Antibody (4F10)
Western Blot ILK Antibody (4F10)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Pancreatic
Polypeptide/PP Antibo
NB100-1793
Flow Cytometry Pancreatic Polypeptide/PP Antibody
Immunohistochemistry-Paraffin Pancreatic Polypeptide/PP Antibody
Immunocytochemistry/ Immunofluorescence Pancreatic Polypeptide/PP Antibody
(3 Reviews)
(19 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
PINCH1/LIMS1
Antibody (591604)
MAB6257
Western Blot PINCH1/LIMS1 Antibody (591604)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
HMG-CoA
Reductase/HMGCR Antib ...
NBP2-66888
Simple Western HMG-CoA Reductase/HMGCR Antibody (JF0981)
Western Blot HMG-CoA Reductase/HMGCR Antibody (JF0981)
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: IHC-P, IP, Simple Western, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Complement
Component C2 Antibody ...
AF1936
Complement Component C2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IP, WB

SLC6A4/5-HTTLPR/Seroto ...
H00006532-D01P
Flow Cytometry SLC6A4/5-HTTLPR/Serotonin transporter Antibody
Western Blot SLC6A4/5-HTTLPR/Serotonin transporter Antibody
Western Blot SLC6A4/5-HTTLPR/Serotonin transporter Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
INPP1 Recombinant
Protein Antigen
NBP1-85889PEP
INPP1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for INPP1 Protein (NBP1-85889PEP) (0)

There are no publications for INPP1 Protein (NBP1-85889PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INPP1 Protein (NBP1-85889PEP) (0)

There are no reviews for INPP1 Protein (NBP1-85889PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for INPP1 Protein (NBP1-85889PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional INPP1 Products

Research Areas for INPP1 Protein (NBP1-85889PEP)

Find related products by research area.

Blogs on INPP1

There are no specific blogs for INPP1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our INPP1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol INPP1