![Western Blot: GGPS1 Antibody [NBP1-83368] - Analysis in control (vector only transfected HEK293T lysate) and GGPS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/GGPS1-Antibody-Western-Blot-NBP1-83368-img0010.jpg "Western Blot: GGPS1 Antibody [NBP1-83368] - Analysis in control (vector only transfected HEK293T lysate) and GGPS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKE |
| Predicted Species | Mouse (91%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GGPS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for GGPS1 Antibody (NBP1-83368)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GGPS1 |
![Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/GGPS1-Antibody-Immunohistochemistry-Paraffin-NBP1-83368-img0012.jpg "Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: GGPS1 Antibody [NBP1-83368] - Analysis in human cell line RT-4.](http://images.novusbio.com/fullsize/GGPS1-Antibody-Western-Blot-NBP1-83368-img0009.jpg "Western Blot: GGPS1 Antibody [NBP1-83368] - Analysis in human cell line RT-4.")
![Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/GGPS1-Antibody-Immunohistochemistry-Paraffin-NBP1-83368-img0006.jpg "Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/GGPS1-Antibody-Immunohistochemistry-Paraffin-NBP1-83368-img0007.jpg "Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining in human testis and pancreas tissues using anti-GGPS1 antibody. Corresponding GGPS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GGPS1-Antibody-Immunohistochemistry-Paraffin-NBP1-83368-img0008.jpg "Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining in human testis and pancreas tissues using anti-GGPS1 antibody. Corresponding GGPS1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Analysis in human testis and skeletal muscle tissues. Corresponding GGPS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GGPS1-Antibody-Immunohistochemistry-Paraffin-NBP1-83368-img0011.jpg "Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Analysis in human testis and skeletal muscle tissues. Corresponding GGPS1 RNA-seq data are presented for the same tissues.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")