Home » Hydroxyacid Oxidase-1/HAO-1 » HAO-1 Peptides and Proteins » Hydroxyacid Oxidase-1/HAO-1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Hydroxyacid Oxidase-1/HAO-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Hydroxyacid Oxidase-1/HAO-1 Recombinant Protein Antigen (NBP3-16999PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Hydroxyacid Oxidase-1/HAO-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Hydroxyacid Oxidase-1/HAO-1

Source: E. coli

Amino Acid Sequence: LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HAO1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-16999.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Hydroxyacid Oxidase-1/HAO-1 Recombinant Protein Antigen

  • (S)-2-hydroxy-acid oxidase
  • EC 1.1.3.15
  • Glycolate oxidase
  • GOX
  • GOX1MGC142227
  • GOXMGC142225
  • HAO1
  • HAO-1
  • HAOX1
  • hydroxyacid oxidase (glycolate oxidase) 1
  • hydroxyacid oxidase 1
  • Hydroxyacid Oxidase1
  • Hydroxyacid Oxidase-1

Background

HAO1 is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed primarily in liver and pancreas and the encoded protein is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids. The transcript detected at high levels in pancreas may represent an alternatively spliced form or the use of a multiple near-consensus upstream polyadenylation site. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
DAO Antibody -
Azide and BSA Free
NBP2-92892
Immunocytochemistry/ Immunofluorescence DAO Antibody - Azide and BSA Free
Western Blot DAO Antibody - Azide and BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
HAO2 GST (N-Term) Pro ...
H00051179-P01
Other Recombinant Human HAO2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
FMN1 Antibody (4F4)
H00342184-M07
ELISA FMN1 Antibody (4F4)
Immunocytochemistry/ Immunofluorescence FMN1 Antibody (4F4)
Western Blot FMN1 Antibody (4F4)
Species: Hu
Applications: ELISA, ICC/IF, WB
Triosephosphate
isomerase Antibody
NBP1-31470
Western Blot Triosephosphate isomerase Antibody
Western Blot Triosephosphate isomerase Antibody
Immunocytochemistry/ Immunofluorescence Triosephosphate isomerase Antibody
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MDH2 Antibody
NBP1-32259
Western Blot MDH2 Antibody
Western Blot MDH2 Antibody
Immunohistochemistry-Paraffin MDH2 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
FANCD2 Antibody -
BSA Free
NB100-182
Immunocytochemistry/ Immunofluorescence FANCD2 Antibody - BSA Free
Knockdown Validated FANCD2 Antibody - BSA Free
Western Blot FANCD2 Antibody - BSA Free
(8 Reviews)
(229 Publications)
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
BRCA2 Antibody
(234403) [Unconjugate
MAB2476
Western Blot BRCA2 Antibody (234403) [Unconjugated]
Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]
Western Blot BRCA2 Antibody (234403) [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, WB
Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AGXT Antibody
NBP1-89200
Immunohistochemistry-Paraffin AGXT Antibody
Immunohistochemistry-Paraffin AGXT Antibody
Immunohistochemistry-Paraffin AGXT Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
Glutathione
Reductase Antibody
NBP2-16684
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
CD31/PECAM-1
Antibody [Unconjugate
AF3628
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
(6 Reviews)
(504 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Timeless Antibody
NB100-40853
Western Blot Timeless Antibody
Immunohistochemistry-Paraffin Timeless Antibody
Western Blot Timeless Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
TIM-1/KIM-1/HAVCR
Antibody [Unconjugate ...
AF1817
Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]
Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]
(105 Publications)
Species: Mu
Applications: WB
Complement
Component C2 Antibody ...
AF1936
Complement Component C2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IP, WB
ARHGEF5 Antibody
NB100-2559
Western Blot ARHGEF5 Antibody
Immunohistochemistry-Paraffin ARHGEF5 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB

Publications for Hydroxyacid Oxidase-1/HAO-1 Recombinant Protein Antigen (NBP3-16999PEP) (0)

There are no publications for Hydroxyacid Oxidase-1/HAO-1 Recombinant Protein Antigen (NBP3-16999PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hydroxyacid Oxidase-1/HAO-1 Recombinant Protein Antigen (NBP3-16999PEP) (0)

There are no reviews for Hydroxyacid Oxidase-1/HAO-1 Recombinant Protein Antigen (NBP3-16999PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Hydroxyacid Oxidase-1/HAO-1 Recombinant Protein Antigen (NBP3-16999PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hydroxyacid Oxidase-1/HAO-1 Products

Research Areas for Hydroxyacid Oxidase-1/HAO-1 Recombinant Protein Antigen (NBP3-16999PEP)

Find related products by research area.

Blogs on Hydroxyacid Oxidase-1/HAO-1

There are no specific blogs for Hydroxyacid Oxidase-1/HAO-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

CD31/PECAM-1 was detected in immersion fixed frozen sections of mouse embryo (E13.5) using Goat Anti-Human/Mouse/Rat CD31/PECAM-1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3628) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; NL001) and counterstained with DAPI (blue). Specific staining was localized to developing endothelium. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
CD31/PECAM-1 Antibody [Unconjugated]
AF3628
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human liver and endometrium tissues using NBP2-14080 antibody. Corresponding HAO1 RNA-seq data are presented for the same tissues.
Hydroxyacid Oxidase-1/HAO-1 Antibody
NBP2-14080
Immunocytochemistry/Immunofluorescence: FANCD2 Antibody - BSA Free [NB100-182] - FANCD2 Antibody [NB100-182] - Analysis using the Biotin conjugate of FANCD2 Antibody. FANCD2 colocalizes in vivo with another protein in SiHa cells after cell exposure to IR. Proliferating SiHa cells were exposed to 10 Gy of IR and double color immunofluorescence staining was performed after 8 h. Images were captured in a Kodak digital image system on a Leica fluorescence microscope.
FANCD2 Antibody - BSA Free
NB100-182

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Hydroxyacid Oxidase-1/HAO-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HAO1