![Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human liver and endometrium tissues using NBP2-14080 antibody. Corresponding HAO1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Hydroxyacid-Oxidase-1-HAO-1-Antibody-Immunohistochemistry-Paraffin-NBP2-14080-img0006.jpg "Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human liver and endometrium tissues using NBP2-14080 antibody. Corresponding HAO1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, CaSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: QHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HAO1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Immunohistochemistry_10287.jpg)
![Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Flow_Cytometry_16017.jpg)
![Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Immunohistochemistry_21486.jpg)
| Publication using NBP2-14080 | Applications | Species |
|---|---|---|
| Kampf C, Mardinoglu A, Fagerberg L et al. The human liver-specific proteome defined by transcriptomics and antibody-based profiling. FASEB J 2014-07-01 [PMID: 24648543] |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Vojtech Gabriel |
IHC-P | Turtle | 05/11/2022 |
Summary
|
|||||||||||
|
reviewed by:
Hannah Wickham |
IHC-P | Canine | 03/11/2022 |
Summary
Comments
|
|||||||||||
Enlarge |
reviewed by:
Faye Doherty |
IHC-P | Mouse | 07/01/2019 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Vojtech Gabriel 05/11/2022 |
||
| Application: | IHC-P | |
| Species: | Turtle |
| Hannah Wickham 03/11/2022 |
||
| Application: | IHC-P | |
| Species: | Canine |
| Faye Doherty 07/01/2019 |
||
| Application: | IHC-P | |
| Species: | Mouse |
| Gene Symbol | HAO1 |
![Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human liver tissue.](http://images.novusbio.com/fullsize/Hydroxyacid-Oxidase-1-HAO-1-Antibody-Western-Blot-NBP2-14080-img0012.jpg "Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human liver tissue.")
![Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Hydroxyacid Oxidase-1/HAO-1 antibody was used on canine paraffin-embedded liver tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Tris/EDTA buffer for two hours at 75C. Image from verified customer review.](http://images.novusbio.com/fullsize/Hydroxyacid-Oxidase-1-HAO-1-Antibody-Immunohistochemistry-Paraffin-NBP2-14080-img0011.jpg "Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Hydroxyacid Oxidase-1/HAO-1 antibody was used on canine paraffin-embedded liver tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Tris/EDTA buffer for two hours at 75C. Image from verified customer review.")
![Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Hydroxyacid-Oxidase-1-HAO-1-Antibody-Immunohistochemistry-Paraffin-NBP2-14080-img0007.jpg "Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human liver shows strong granular cytoplasm positivity in hepatocytes.](http://images.novusbio.com/fullsize/Hydroxyacid-Oxidase-1-HAO-1-Antibody-Immunohistochemistry-Paraffin-NBP2-14080-img0008.jpg "Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human liver shows strong granular cytoplasm positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human testis shows moderate granular cytoplasm positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Hydroxyacid-Oxidase-1-HAO-1-Antibody-Immunohistochemistry-Paraffin-NBP2-14080-img0010.jpg "Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human testis shows moderate granular cytoplasm positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human prostate shows no positivity in glandular cells.](http://images.novusbio.com/fullsize/Hydroxyacid-Oxidase-1-HAO-1-Antibody-Immunohistochemistry-Paraffin-NBP2-14080-img0009.jpg "Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human prostate shows no positivity in glandular cells.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]](https://images.novusbio.com/images2/TIM1_AF1817_Western_Blot_17317.jpg)
![Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]](https://images.novusbio.com/images/af1817_mouse-tim-1-kim-1-havcr-affinity-purified-polyclonal-ab-4120241049450.jpg)
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
