Novus Biologicals products are now on bio-techne.com

HSPH1/HSP105 Recombinant Protein Antigen

Images

 
There are currently no images for HSPH1/HSP105 Protein (NBP1-89662PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

HSPH1/HSP105 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSPH1.

Source: E. coli

Amino Acid Sequence: TQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSPH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89662.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HSPH1/HSP105 Recombinant Protein Antigen

  • Antigen NY-CO-25
  • heat shock 105kD beta
  • heat shock 105kDa protein 1
  • heat shock 105kDa/110kDa protein 1
  • Heat shock 110 kDa protein
  • heat shock protein 105 kDa
  • HSP105a
  • HSP105B
  • HSP105heat shock 105kD alpha
  • HSP110
  • HSPH1
  • KIAA0201DKFZp686M05240
  • NY-CO-25

Background

The heat shock proteins (HSPs) comprise a group of highly conserved, abundantly expressed proteins with diverse functions, including the assembly and sequestering of multiprotein complexes, transportation of nascent polypeptide chains across cellular membranes and regulation of protein folding. Heat shock proteins (also known as molecular chaperones) fall into six general families: HSP 90, HSP 70, HSP 60, the low molecular weight HSPs, the immunophilins and the HSP 110 family. The HSP 110 family (also known as the HSP 105 family) is composed of HSP 105, Apg-1 and Apg-2. HSP 105 is a testis-specific and HSP 90-related protein. Research indicates that HSP 105 is specifically localized in the germ cells and may translocate into the nucleus after heat shock. It is suggested that HSP 105 may contribute to the stabilization of p53 proteins in the cytoplasm of the germ cells, preventing the potential induction of apoptosis by p53.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-48700
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32140
Species: Hu, Mu, Pl, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
DYC1663-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP1-33548
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
1129-ER
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-89662PEP
Species: Hu
Applications: AC

Publications for HSPH1/HSP105 Protein (NBP1-89662PEP) (0)

There are no publications for HSPH1/HSP105 Protein (NBP1-89662PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSPH1/HSP105 Protein (NBP1-89662PEP) (0)

There are no reviews for HSPH1/HSP105 Protein (NBP1-89662PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HSPH1/HSP105 Protein (NBP1-89662PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HSPH1/HSP105 Products

Research Areas for HSPH1/HSP105 Protein (NBP1-89662PEP)

Find related products by research area.

Blogs on HSPH1/HSP105

There are no specific blogs for HSPH1/HSP105, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HSPH1/HSP105 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPH1