Home » HO-1/HMOX1/HSP32 » HO-1/HMOX1/HSP32 Proteins » Recombinant Rat HO-1/HMOX1/HSP32 His Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Rat HO-1/HMOX1/HSP32 His Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Rat HO-1/HMOX1/HSP32 His Protein [NBP3-18328] - SDS-PAGE of ~32 kDa rat HO-1/HMOX1/HSP32 protein (NBP3-18328).
SDS-Page: Recombinant Rat HO-1/HMOX1/HSP32 His Protein [NBP3-18328] - SDS-PAGE of ~32 kDa rat HO-1/HMOX1/HSP32 protein (NBP3-18328).

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB, PAGE

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Rat HO-1/HMOX1/HSP32 His Protein Summary

Description
A partial recombinant protein corresponding to rat HO-1/HMOX1/HSP32.

Source: E. coli

Amino Acid Sequence: MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQIST
Localization
Microsome|Endoplasmic Reticulum
Preparation
Method
This protein is affinity purified.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HMOX1
Purity
>85%

Applications/Dilutions

Dilutions
  • SDS-Page
  • Western Blot
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
50mM Tris/HCl pH7.5, 5mM Bme, 0.15NaCl, 10% glycerol
Preservative
No Preservative
Purity
>85%

Alternate Names for Recombinant Rat HO-1/HMOX1/HSP32 His Protein

  • bK286B10
  • EC 1.14.99.3
  • heat shock protein, 32-kD
  • heme oxygenase (decycling) 1
  • HMOX1
  • HO
  • HO1
  • HO-1
  • HO-1heme oxygenase 1
  • HSP32

Background

Stressed mammalian cells up-regulate heme oxygenase 1 (HO-1), which catabolizes heme to biliverdin, carbon monoxide, and free iron. Results provide genetic evidence that up-regulation of HO-1 serves as an adaptive mechanism to protect cells from oxidative damage during stress (1). When cells are injured they release their contents, resulting in a local accumulation of free heme proteins and heme. HO-1 plays a crucial role in the inflammatory process during wound healing (2). TNFalpha accelerates inflammatory responses by down-regulating HO-1 expression in human monocytes. TNF antagonists may block this TNF-dependent suppression of HO-1 expression, resulting in an amelioration of inflammation (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Nrf2 Antibody
NBP1-32822
Western Blot Nrf2 Antibody
Western Blot Nrf2 Antibody
Western Blot Nrf2 Antibody
(4 Reviews)
(71 Publications)
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
HO-2/HMOX2
Antibody (OTI1C2)
NBP2-01407
Flow Cytometry HO-2/HMOX2 Antibody (OTI1C2)
Western Blot HO-2/HMOX2 Antibody (OTI1C2)
Immunohistochemistry-Paraffin HO-2/HMOX2 Antibody (OTI1C2)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
GABPA Antibody
NBP1-32105
Immunocytochemistry/ Immunofluorescence GABPA Antibody
Immunoprecipitation GABPA Antibody
Immunohistochemistry-Paraffin GABPA Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
ISYNA1 Antibody
NBP2-47415
Immunocytochemistry/ Immunofluorescence ISYNA1 Antibody
Immunohistochemistry-Paraffin ISYNA1 Antibody
Immunohistochemistry-Paraffin ISYNA1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(667 Publications)
Species: Mu
Applications: ELISA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(302 Publications)
Species: Mu
Applications: ELISA
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(685 Publications)
Species: Hu
Applications: ELISA
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
nNOS Antibody
NB100-858
Immunocytochemistry/ Immunofluorescence nNOS Antibody
Flow Cytometry nNOS Antibody
Immunocytochemistry/ Immunofluorescence nNOS Antibody
(1 Review)
(15 Publications)
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Nanos2 Antibody -
BSA Free
NBP1-76917
Immunocytochemistry/ Immunofluorescence Nanos2 Antibody - BSA Free
Western Blot Nanos2 Antibody - BSA Free
Immunohistochemistry-Paraffin Nanos2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
eNOS Antibody -
BSA Free
NB300-500
Western Blot eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
(3 Reviews)
(28 Publications)
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Recombinant Rat
HO-1/HMOX1/HSP32 His ...
NBP3-18328
Recombinant Rat HO-1/HMOX1/HSP32 His Protein
Species: Rt
Applications: WB, PAGE

Publications for HO-1/HMOX1/HSP32 Partial Recombinant Protein (NBP3-18328) (0)

There are no publications for HO-1/HMOX1/HSP32 Partial Recombinant Protein (NBP3-18328).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HO-1/HMOX1/HSP32 Partial Recombinant Protein (NBP3-18328) (0)

There are no reviews for HO-1/HMOX1/HSP32 Partial Recombinant Protein (NBP3-18328). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HO-1/HMOX1/HSP32 Partial Recombinant Protein (NBP3-18328) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HO-1/HMOX1/HSP32 Products

Research Areas for HO-1/HMOX1/HSP32 Partial Recombinant Protein (NBP3-18328)

Find related products by research area.

Blogs on HO-1/HMOX1/HSP32

There are no specific blogs for HO-1/HMOX1/HSP32, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow Cytometry: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Analysis of 10^6 Jurkat cells stained using HO-1 monoclonal antibody (HO-1-1), (Prod. No. ADI-OSA-110), at a concentration of 50 ug/mL
HO-1/HMOX1/HSP32 Antibody (HO-1-1)
NBP1-97507-0.05mg

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Rat HO-1/HMOX1/HSP32 His Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol HMOX1