![Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in transfected 293T cell line by HDAC1 monoclonal antibody (M14), clone 5C11. Lane 1: HDAC1 transfected lysatE (55.1 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/HDAC1-Antibody-5C11-Western-Blot-H00003065-M14-img0016.jpg "Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in transfected 293T cell line by HDAC1 monoclonal antibody (M14), clone 5C11. Lane 1: HDAC1 transfected lysatE (55.1 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, Func, ICC/IF, IHC, IP |
| Clone | 5C11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | HDAC1 (AAH00301, 1 a.a. ~ 482 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA |
| Specificity | HDAC1 (5C11) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | HDAC1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00003065-M14 | Applications | Species |
|---|---|---|
| Nakayama T, Mikoshiba K, Akagawa K. The cell- and tissue-specific transcription mechanism of the TATA-less syntaxin 1A gene. FASEB J 2016-02-01 [PMID: 26391271] |
Secondary Antibodies |
Isotype Controls |
Research Areas for HDAC1 Antibody (H00003065-M14)Find related products by research area.
|
|
The role of DNMT3B in the co-incidence of methyltransferase and tumor suppressor expression in malignancies Epigenetics is the process of heritable change in gene activity despite alteration of the hosts DNA sequence, essentially causing a change in a phenotype without a change in the genotype of a host. To change the gene sequence without interfering w... Read full blog post. |
|
The role of DNMT3A in development Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence. Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation. Gene silencing in DNA ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of monoclonal antibody to HDAC1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/HDAC1-Antibody-5C11-Immunocytochemistry-Immunofluorescence-H00003065-M14-img0009.jpg "Immunocytochemistry/Immunofluorescence: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of monoclonal antibody to HDAC1 on HeLa cell. Antibody concentration 10 ug/ml")
![Immunohistochemistry-Paraffin: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize/HDAC1-Antibody-5C11-Immunohistochemistry-Paraffin-H00003065-M14-img0010.jpg "Immunohistochemistry-Paraffin: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 3 ug/ml")
![Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/fullsize/HDAC1-Antibody-5C11-Western-Blot-H00003065-M14-img0012.jpg "Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in PC-12 (Cat # L012V1).")
![Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in Hela S3 NE (Cat # L013V3).](http://images.novusbio.com/fullsize/HDAC1-Antibody-5C11-Western-Blot-H00003065-M14-img0013.jpg "Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in Hela S3 NE (Cat # L013V3).")
![Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in Raw 264.7 (Cat # L024V1).](http://images.novusbio.com/fullsize/HDAC1-Antibody-5C11-Western-Blot-H00003065-M14-img0014.jpg "Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in Raw 264.7 (Cat # L024V1).")
![Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in NIH/3T3 (Cat # L018V1).](http://images.novusbio.com/fullsize/HDAC1-Antibody-5C11-Western-Blot-H00003065-M14-img0015.jpg "Western Blot: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of HDAC1 expression in NIH/3T3 (Cat # L018V1).")
![ELISA: HDAC1 Antibody (5C11) [H00003065-M14] - Detection limit for recombinant GST tagged HDAC1 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/HDAC1-Antibody-5C11-ELISA-H00003065-M14-img0008.jpg "ELISA: HDAC1 Antibody (5C11) [H00003065-M14] - Detection limit for recombinant GST tagged HDAC1 is approximately 0.1ng/ml as a capture antibody.")
![Proximity Ligation Assay: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of protein-protein interactions between NFKB1 and HDAC1. HeLa cells were stained with anti-NFKB1 rabbit purified polyclonal 1:1200 and anti-HDAC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/fullsize/HDAC1-Antibody-5C11-Proximity-Ligation-Assay-H00003065-M14-img0011.jpg "Proximity Ligation Assay: HDAC1 Antibody (5C11) [H00003065-M14] - Analysis of protein-protein interactions between NFKB1 and HDAC1. HeLa cells were stained with anti-NFKB1 rabbit purified polyclonal 1:1200 and anti-HDAC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![COCO/DAND5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "COCO/DAND5 [Unconjugated]")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")