Home » GM130/GOLGA2 » GM130/GOLGA2 Proteins » GM130/GOLGA2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

GM130/GOLGA2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GM130/GOLGA2 Protein (NBP1-89757PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GM130/GOLGA2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GOLGA2.

Source: E. coli

Amino Acid Sequence: DTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GOLGA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89757.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GM130/GOLGA2 Recombinant Protein Antigen

  • 130 kDa cis-Golgi matrix protein
  • GM130 autoantigen
  • GM130
  • GM130Golgi matrix protein GM130
  • GOLGA2
  • golgi autoantigen, golgin subfamily a, 2
  • golgin A2
  • Golgin subfamily A member 2
  • Golgin-95
  • MGC20672
  • SY11 Protein

Background

Golgi Matrix Protein (GM130) is peripheral cytoplamic protein that is bound to the Golgi membranes. It has been implicated as a maintainer of cis-Golgi structure (1). During mitosis, it regulates the disassembly and reassembly of the Golgi complex. It is also linked to docking and fusion of coatomer (COP I) coated vesicles to the Golgi membrane (2). The COOH-terminal domain of GM130 is highly homologous to Golgi human auto-antigen, golgin-95. GM130 interacts specifically and GTP-dependent manner with Rab1b protein, a regulator of anterograde traffic between ER and Golgi membranes (3). GM130 is also activator of YSK1, an essential player in cell migration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GOLGB1/Giantin
Antibody
NBP2-22321
Immunocytochemistry/ Immunofluorescence GOLGB1/Giantin Antibody
Immunocytochemistry/ Immunofluorescence GOLGB1/Giantin Antibody
Immunocytochemistry/ Immunofluorescence GOLGB1/Giantin Antibody
(2 Reviews)
(6 Publications)
Species: Hu
Applications: ICC/IF, IP, WB
VDP p115 Antibody
NBP3-38014
Immunocytochemistry/ Immunofluorescence VDP p115 Antibody
Immunohistochemistry VDP p115 Antibody
Western Blot VDP p115 Antibody
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ARHGAP4 Antibody
NBP1-88527
Western Blot ARHGAP4 Antibody
Immunohistochemistry-Paraffin ARHGAP4 Antibody
Immunohistochemistry-Paraffin ARHGAP4 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Flow Cytometry GRASP65 Antibody (OTI5G8)
(3 Reviews)
(2 Publications)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
GOLPH3 Antibody
NBP2-75515
Flow Cytometry GOLPH3 Antibody
Immunocytochemistry/ Immunofluorescence GOLPH3 Antibody
Immunocytochemistry/ Immunofluorescence GOLPH3 Antibody
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
TGN46 Antibody -
BSA Free
NBP1-49643
Flow (Intracellular) TGN46 Antibody - BSA Free
Flow (Intracellular) TGN46 Antibody - BSA Free
Immunohistochemistry TGN46 Antibody - BSA Free
(2 Reviews)
(33 Publications)
Species: Bv, Hu, Pm
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KO, WB
Rab1A Antibody
NBP1-55113
Western Blot Rab1A Antibody
Western Blot Rab1A Antibody
Immunohistochemistry Rab1A Antibody
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
GOLGA3 Antibody
NBP1-91953
Immunocytochemistry/ Immunofluorescence GOLGA3 Antibody
Immunohistochemistry-Paraffin GOLGA3 Antibody
Immunohistochemistry-Paraffin GOLGA3 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NSF Antibody
NBP1-87035
Immunocytochemistry/ Immunofluorescence NSF Antibody
Immunohistochemistry-Paraffin NSF Antibody
Western Blot NSF Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SAR1 Antibody
NBP1-80789
Immunohistochemistry-Paraffin SAR1 Antibody
Western Blot SAR1 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, KD, WB
Golgin 97 Antibody
NBP2-38528
Immunocytochemistry/ Immunofluorescence Golgin 97 Antibody
Immunohistochemistry-Paraffin Golgin 97 Antibody
Immunohistochemistry-Paraffin Golgin 97 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
EEA1 Antibody
(6D4.1D4) - BSA Free
NBP2-36568
Flow (Intracellular) EEA1 Antibody (6D4.1D4) - BSA Free
Immunohistochemistry-Paraffin EEA1 Antibody (6D4.1D4) - BSA Free
Immunohistochemistry-Paraffin EEA1 Antibody (6D4.1D4) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
IQGAP1 Antibody
(2C5)
H00008826-M01
Knockdown Validated IQGAP1 Antibody (2C5)
Western Blot IQGAP1 Antibody (2C5)
Western Blot IQGAP1 Antibody (2C5)
(5 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
GRASP55 Antibody
NBP1-89747
Immunocytochemistry/ Immunofluorescence GRASP55 Antibody
Western Blot GRASP55 Antibody
Immunohistochemistry-Paraffin GRASP55 Antibody
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
CDC2/CDK1 Antibody
NBP1-85729
Immunohistochemistry-Paraffin CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GOLGA5 Antibody
NBP1-83352
Immunocytochemistry/ Immunofluorescence GOLGA5 Antibody
Immunohistochemistry GOLGA5 Antibody
Immunohistochemistry GOLGA5 Antibody
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
GOSR1 Antibody
H00009527-B01P
Immunocytochemistry/ Immunofluorescence GOSR1 Antibody
Western Blot GOSR1 Antibody
Western Blot GOSR1 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, WB
Syntaxin 5
Antibody [Unconjugate
AF5687
Simple Western Syntaxin 5 Antibody [Unconjugated]
Western Blot Syntaxin 5 Antibody [Unconjugated]
Immunohistochemistry Syntaxin 5 Antibody [Unconjugated]
Species: Hu, Rt
Applications: ICC, IHC, Simple Western, WB
beta COP Antibody
NBP2-15578
Western Blot beta COP Antibody
Immunohistochemistry-Paraffin beta COP Antibody
Immunocytochemistry/ Immunofluorescence beta COP Antibody
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GM130/GOLGA2
Recombinant Protein A ...
NBP1-89757PEP
GM130/GOLGA2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for GM130/GOLGA2 Protein (NBP1-89757PEP) (0)

There are no publications for GM130/GOLGA2 Protein (NBP1-89757PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GM130/GOLGA2 Protein (NBP1-89757PEP) (0)

There are no reviews for GM130/GOLGA2 Protein (NBP1-89757PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GM130/GOLGA2 Protein (NBP1-89757PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GM130/GOLGA2 Products

Research Areas for GM130/GOLGA2 Protein (NBP1-89757PEP)

Find related products by research area.

Blogs on GM130/GOLGA2

There are no specific blogs for GM130/GOLGA2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow (Intracellular): TGN46 Antibody [NBP1-49643] - An intracellular stain was performed on U-937 cells with NBP1-49643 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by rabbit IgG APC-conjugated secondary antibody (F0111, R&D Systems).
TGN46 Antibody - BSA Free
NBP1-49643

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GM130/GOLGA2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GOLGA2