Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, IHC |
Clone | 53/1 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Format | BSA Free |
Concentration | 1 mg/ml |
Immunogen | Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9 |
Isotype | IgG1 |
Clonality | Monoclonal |
Host | Mouse |
Gene | GDF9 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Clone 53/1 can be used in assays to detect oocyte expression and has been shown to neutralize GDF-9 biological activity. Positive control(s): Ovary |
Theoretical MW | 17.5 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS |
Preservative | 0.02% Sodium Azide |
Concentration | 1 mg/ml |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GDF-9 Antibody (NBP2-61934)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | GDF9 |