![Western Blot: GATA-2 Antibody [NBP1-82581] - Microarray gene expression data. A number of genes were validated for gene expression changes by Western blot analysis. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/1296), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/GATA-2-Antibody-Western-Blot-NBP1-82581-img0026.jpg "Western Blot: GATA-2 Antibody [NBP1-82581] - Microarray gene expression data. A number of genes were validated for gene expression changes by Western blot analysis. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/1296), licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GATA2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Theoretical MW | 51 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IP | Human | 06/29/2020 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for GATA-2 Antibody (NBP1-82581)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: GATA-2 Antibody [NBP1-82581] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/GATA-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82581-img0025.jpg "Immunocytochemistry/Immunofluorescence: GATA-2 Antibody [NBP1-82581] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human placenta shows nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/GATA-2-Antibody-Immunohistochemistry-Paraffin-NBP1-82581-img0022.jpg "Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human placenta shows nuclear positivity in trophoblastic cells.")
![Western Blot: GATA-2 Antibody [NBP1-82581] - Analysis in human cell line SH-SY5Y.](http://images.novusbio.com/fullsize/GATA-2-Antibody-Western-Blot-NBP1-82581-img0014.jpg "Western Blot: GATA-2 Antibody [NBP1-82581] - Analysis in human cell line SH-SY5Y.")
![Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human kidney shows nuclear positivity in cells in tubules.](http://images.novusbio.com/fullsize/GATA-2-Antibody-Immunohistochemistry-Paraffin-NBP1-82581-img0020.jpg "Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human kidney shows nuclear positivity in cells in tubules.")
![Simple Western: GATA-2 Antibody [NBP1-82581] - Simple Western lane view shows a specific band for GATA2 in 0.2 mg/mL of HELA lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/GATA-2-Antibody-Simple-Western-NBP1-82581-img0006.jpg "Simple Western: GATA-2 Antibody [NBP1-82581] - Simple Western lane view shows a specific band for GATA2 in 0.2 mg/mL of HELA lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: GATA-2 Antibody [NBP1-82581] - Electropherogram image(s) of corresponding Simple Western lane view. GATA-2 antibody was used at 1:100 dilution on HELA lysate(s).](http://images.novusbio.com/fullsize/GATA-2-Antibody-Simple-Western-NBP1-82581-img0007.jpg "Simple Western: GATA-2 Antibody [NBP1-82581] - Electropherogram image(s) of corresponding Simple Western lane view. GATA-2 antibody was used at 1:100 dilution on HELA lysate(s).")
![Western Blot: GATA-2 Antibody [NBP1-82581] - Knock-down of GATA2 gene expression decreases proliferation, migration & matrigel invasion of prostate cancer cellsTreatment of LNCaP cells with siGATA2 leads to A, a marked reduction in GATA2 protein levels; & B, a marked decrease in cell proliferation. C, a monolayer of LNCaP cells was scratched to examine the rate of cell migration into the wounded area. The bar graph represents the percentage of cell-recovered wound areas after 8 hours of incubation (*, p<0.01). Representative images of the wound captured at different time points are shown (at right). D & E, cell migration & matrigel invasion assays show a marked decrease in cell motility & tissue invasiveness of siGATA2-treated LNCaP cells. Bar graphs show the percentage of migrated/invaded cells after a 20-hr incubation. Results (A-E) shown are representative of three individual experiments with error bars representing standard deviation based on triplicates. Statistical significance was established using the Student's t-test. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/24448395), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82581_rabbit-polyclonal-gata-2-antibody-310202416121995.jpg "Western Blot: GATA-2 Antibody [NBP1-82581] - Knock-down of GATA2 gene expression decreases proliferation, migration & matrigel invasion of prostate cancer cellsTreatment of LNCaP cells with siGATA2 leads to A, a marked reduction in GATA2 protein levels; & B, a marked decrease in cell proliferation. C, a monolayer of LNCaP cells was scratched to examine the rate of cell migration into the wounded area. The bar graph represents the percentage of cell-recovered wound areas after 8 hours of incubation (*, p<0.01). Representative images of the wound captured at different time points are shown (at right). D & E, cell migration & matrigel invasion assays show a marked decrease in cell motility & tissue invasiveness of siGATA2-treated LNCaP cells. Bar graphs show the percentage of migrated/invaded cells after a 20-hr incubation. Results (A-E) shown are representative of three individual experiments with error bars representing standard deviation based on triplicates. Statistical significance was established using the Student's t-test. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/24448395), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot GATA-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA-2_AF2046_Western_Blot_5163.jpg)
![Simple Western GATA-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA2_AF2046_Simple_Western_16938.jpg)
![Western Blot GATA-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA2_AF2046_Western_Blot_22630.jpg)
![Western Blot GATA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA-3_AF2605_Western_Blot_5199.jpg)
![Immunocytochemistry GATA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA-3_AF2605_Immunocytochemistry_6486.jpg)
![Simple Western GATA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA3_AF2605_Simple_Western_16988.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![SDS-PAGE IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_345.jpg)
![Bioactivity IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_347.jpg)
![SEC-MALS IL-3 [Unconjugated]](https://images.novusbio.com/images/203-il_recombinant-human-il-3-protein-sec-mals-133202482656..jpg)
![Immunocytochemistry LMO2 Antibody [Unconjugated]](https://images.novusbio.com/images2/LMO2_AF2726_Immunocytochemistry_10616.jpg)
![Flow Cytometry LMO2 Antibody [Unconjugated]](https://images.novusbio.com/images2/LMO2_AF2726_Flow_Cytometry_22133.jpg)
![Flow Cytometry LMO2 Antibody [Unconjugated]](https://images.novusbio.com/images2/LMO2_AF2726_Flow_Cytometry_22134.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
